BLASTX nr result
ID: Rehmannia28_contig00016414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016414 (552 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDY30284.1| BnaC04g31950D [Brassica napus] 53 3e-06 gb|KFK33162.1| hypothetical protein AALP_AA6G338500 [Arabis alpina] 52 4e-06 >emb|CDY30284.1| BnaC04g31950D [Brassica napus] Length = 80 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 266 QEKMMKAPGRDYYMPRKDFEESPSDYFRNLRGKE 165 +EKMMKAPG+D Y+ R+DFE S DYF++LRGK+ Sbjct: 47 EEKMMKAPGKDGYIVRRDFENSAKDYFKDLRGKK 80 >gb|KFK33162.1| hypothetical protein AALP_AA6G338500 [Arabis alpina] Length = 85 Score = 52.4 bits (124), Expect = 4e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 266 QEKMMKAPGRDYYMPRKDFEESPSDYFRNLRGKE 165 QEKMMKAPG+D Y+ R FE +P DYF++LRGK+ Sbjct: 52 QEKMMKAPGKDGYIHRNHFESNPKDYFKDLRGKK 85