BLASTX nr result
ID: Rehmannia28_contig00016048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00016048 (323 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090616.1| PREDICTED: uncharacterized protein LOC105171... 52 9e-06 ref|XP_011090610.1| PREDICTED: uncharacterized protein LOC105171... 52 9e-06 >ref|XP_011090616.1| PREDICTED: uncharacterized protein LOC105171251 isoform X2 [Sesamum indicum] Length = 328 Score = 52.4 bits (124), Expect = 9e-06 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = -1 Query: 323 AWGGFVDPFREHSDRNGGQ----SLQAQSSRGRPKKVVRINIE 207 AWGGF DPF+E S R+G Q S QAQSS +PKKVV INIE Sbjct: 286 AWGGFPDPFKELSGRHGMQSFNRSFQAQSSGDKPKKVVTINIE 328 >ref|XP_011090610.1| PREDICTED: uncharacterized protein LOC105171251 isoform X1 [Sesamum indicum] Length = 349 Score = 52.4 bits (124), Expect = 9e-06 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = -1 Query: 323 AWGGFVDPFREHSDRNGGQ----SLQAQSSRGRPKKVVRINIE 207 AWGGF DPF+E S R+G Q S QAQSS +PKKVV INIE Sbjct: 307 AWGGFPDPFKELSGRHGMQSFNRSFQAQSSGDKPKKVVTINIE 349