BLASTX nr result
ID: Rehmannia28_contig00015742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00015742 (314 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-li... 65 3e-11 ref|XP_012853383.1| PREDICTED: major pollen allergen Lol p 11-li... 60 3e-09 ref|XP_012845347.1| PREDICTED: major pollen allergen Lol p 11-li... 60 3e-09 ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-li... 59 8e-09 gb|EPS69662.1| hypothetical protein M569_05103, partial [Genlise... 52 5e-06 >ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum] Length = 159 Score = 65.5 bits (158), Expect = 3e-11 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -3 Query: 114 MAKLLVVLFALCVVPSIVTAHFMADPLLLKGSVYCDTC 1 MAK L+VLFALCVVPSIVTA F DPLLL G VYCDTC Sbjct: 1 MAKFLLVLFALCVVPSIVTARFANDPLLLTGCVYCDTC 38 >ref|XP_012853383.1| PREDICTED: major pollen allergen Lol p 11-like [Erythranthe guttata] gi|604304757|gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Erythranthe guttata] Length = 160 Score = 60.1 bits (144), Expect = 3e-09 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -3 Query: 114 MAKLL-VVLFALCVVPSIVTAHFMADPLLLKGSVYCDTC 1 MAKLL VVLFA+CVVPSIVTAH D LLL+GS YCD C Sbjct: 1 MAKLLLVVLFAVCVVPSIVTAHIAGDSLLLQGSTYCDAC 39 >ref|XP_012845347.1| PREDICTED: major pollen allergen Lol p 11-like [Erythranthe guttata] gi|604319869|gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata] Length = 161 Score = 60.1 bits (144), Expect = 3e-09 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 105 LLVVLFALCVVPSIVTAHFMADPLLLKGSVYCDTC 1 L+VVLF++CVVP+IVTAHF DP L+KG VYCD+C Sbjct: 6 LVVVLFSVCVVPAIVTAHFAGDPFLVKGCVYCDSC 40 >ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum] Length = 159 Score = 58.9 bits (141), Expect = 8e-09 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 114 MAKLLVVLFALCVVPSIVTAHFMADPLLLKGSVYCDTC 1 MA+ L+VLFA+CV+P+IV+AHF+ DP + GSVYCDTC Sbjct: 1 MARNLLVLFAVCVLPAIVSAHFVRDPFHVTGSVYCDTC 38 >gb|EPS69662.1| hypothetical protein M569_05103, partial [Genlisea aurea] Length = 156 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -3 Query: 105 LLVVLFALCVVPSIVTAHFMADPLLLKGSVYCDTC 1 L VLFALCVVPS+ A + PL+L+GSVYCDTC Sbjct: 4 LAAVLFALCVVPSVYGARYNGVPLVLEGSVYCDTC 38