BLASTX nr result
ID: Rehmannia28_contig00015571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00015571 (426 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098139.1| PREDICTED: endoplasmic reticulum oxidoreduct... 135 5e-35 gb|EYU26254.1| hypothetical protein MIMGU_mgv1a0070612mg, partia... 131 2e-34 emb|CDP06120.1| unnamed protein product [Coffea canephora] 132 5e-34 ref|XP_012850538.1| PREDICTED: endoplasmic reticulum oxidoreduct... 131 9e-34 ref|XP_004243200.1| PREDICTED: endoplasmic reticulum oxidoreduct... 123 1e-30 ref|XP_015080567.1| PREDICTED: endoplasmic reticulum oxidoreduct... 123 1e-30 ref|XP_006366773.1| PREDICTED: endoplasmic reticulum oxidoreduct... 123 1e-30 ref|XP_009769219.1| PREDICTED: endoplasmic reticulum oxidoreduct... 121 5e-30 ref|XP_009601341.1| PREDICTED: endoplasmic reticulum oxidoreduct... 121 5e-30 ref|XP_006370451.1| Endoplasmic oxidoreductin 1 precursor family... 119 2e-29 ref|XP_006478010.1| PREDICTED: endoplasmic reticulum oxidoreduct... 119 3e-29 ref|XP_006441012.1| hypothetical protein CICLE_v10019948mg [Citr... 119 3e-29 ref|XP_006478009.1| PREDICTED: endoplasmic reticulum oxidoreduct... 119 3e-29 ref|XP_006441011.1| hypothetical protein CICLE_v10019948mg [Citr... 119 3e-29 ref|XP_007025023.1| Endoplasmic reticulum oxidoreductins 1 isofo... 118 3e-29 ref|XP_002317004.2| Endoplasmic oxidoreductin 1 precursor family... 119 4e-29 ref|XP_011036224.1| PREDICTED: endoplasmic reticulum oxidoreduct... 119 4e-29 ref|XP_002298934.2| hypothetical protein POPTR_0001s42700g [Popu... 119 4e-29 ref|XP_007025022.1| Endoplasmic reticulum oxidoreductins 1 isofo... 118 9e-29 ref|XP_010062721.1| PREDICTED: endoplasmic reticulum oxidoreduct... 118 1e-28 >ref|XP_011098139.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Sesamum indicum] Length = 472 Score = 135 bits (339), Expect = 5e-35 Identities = 62/70 (88%), Positives = 64/70 (91%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSKN---QKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IAITSK+ KSCQC QDSRKYTGIVEDCCCDYETVDSLNG VLHPLLQ+LVRTPFFRY Sbjct: 40 IAITSKHAHDHKSCQCPQDSRKYTGIVEDCCCDYETVDSLNGGVLHPLLQELVRTPFFRY 99 Query: 32 FKVKLWCDCP 3 FKVKLWCDCP Sbjct: 100 FKVKLWCDCP 109 >gb|EYU26254.1| hypothetical protein MIMGU_mgv1a0070612mg, partial [Erythranthe guttata] Length = 336 Score = 131 bits (329), Expect = 2e-34 Identities = 58/70 (82%), Positives = 65/70 (92%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITS---KNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+TS +N KSC CSQD+RKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV+TPFFRY Sbjct: 11 IAVTSNHAQNHKSCLCSQDARKYTGIVEDCCCDYETVDSVNGAVLHPLLQELVKTPFFRY 70 Query: 32 FKVKLWCDCP 3 +KVKLWCDCP Sbjct: 71 YKVKLWCDCP 80 >emb|CDP06120.1| unnamed protein product [Coffea canephora] Length = 473 Score = 132 bits (332), Expect = 5e-34 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSK---NQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 I++TSK N SCQC+QDSRKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV TPFFRY Sbjct: 37 ISVTSKYTKNPNSCQCAQDSRKYTGIVEDCCCDYETVDSINGAVLHPLLQELVTTPFFRY 96 Query: 32 FKVKLWCDCP 3 FKVKLWCDCP Sbjct: 97 FKVKLWCDCP 106 >ref|XP_012850538.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Erythranthe guttata] Length = 440 Score = 131 bits (329), Expect = 9e-34 Identities = 58/70 (82%), Positives = 65/70 (92%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITS---KNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+TS +N KSC CSQD+RKYTGIVEDCCCDYETVDS+NGAVLHPLLQ+LV+TPFFRY Sbjct: 37 IAVTSNHAQNHKSCLCSQDARKYTGIVEDCCCDYETVDSVNGAVLHPLLQELVKTPFFRY 96 Query: 32 FKVKLWCDCP 3 +KVKLWCDCP Sbjct: 97 YKVKLWCDCP 106 >ref|XP_004243200.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum lycopersicum] Length = 473 Score = 123 bits (309), Expect = 1e-30 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 179 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCP 3 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCP Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCP 108 >ref|XP_015080567.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum pennellii] Length = 474 Score = 123 bits (309), Expect = 1e-30 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 179 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCP 3 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCP Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCP 108 >ref|XP_006366773.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Solanum tuberosum] Length = 474 Score = 123 bits (309), Expect = 1e-30 Identities = 53/59 (89%), Positives = 55/59 (93%) Frame = -2 Query: 179 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCP 3 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCP Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDTINGAVLHPLLQGLVTTPFFRYFKVKLWCDCP 108 >ref|XP_009769219.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana sylvestris] Length = 474 Score = 121 bits (304), Expect = 5e-30 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -2 Query: 179 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCP 3 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCP Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCP 108 >ref|XP_009601341.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana tomentosiformis] Length = 474 Score = 121 bits (304), Expect = 5e-30 Identities = 52/59 (88%), Positives = 54/59 (91%) Frame = -2 Query: 179 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCP 3 K C C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCP Sbjct: 50 KPCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCP 108 >ref|XP_006370451.1| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] gi|550349634|gb|ERP67020.1| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] Length = 426 Score = 119 bits (298), Expect = 2e-29 Identities = 52/68 (76%), Positives = 59/68 (86%), Gaps = 2/68 (2%) Frame = -2 Query: 200 AITSKNQKSCQCS--QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 27 ++ S N KSCQCS QDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLISSNYKSCQCSSAQDSGKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 26 VKLWCDCP 3 VKLWCDCP Sbjct: 113 VKLWCDCP 120 >ref|XP_006478010.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 isoform X2 [Citrus sinensis] Length = 477 Score = 119 bits (299), Expect = 3e-29 Identities = 54/70 (77%), Positives = 58/70 (82%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 32 FKVKLWCDCP 3 FK KLWCDCP Sbjct: 108 FKAKLWCDCP 117 >ref|XP_006441012.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] gi|557543274|gb|ESR54252.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] Length = 477 Score = 119 bits (299), Expect = 3e-29 Identities = 54/70 (77%), Positives = 58/70 (82%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 32 FKVKLWCDCP 3 FK KLWCDCP Sbjct: 108 FKAKLWCDCP 117 >ref|XP_006478009.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 isoform X1 [Citrus sinensis] Length = 478 Score = 119 bits (299), Expect = 3e-29 Identities = 54/70 (77%), Positives = 58/70 (82%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 32 FKVKLWCDCP 3 FK KLWCDCP Sbjct: 108 FKAKLWCDCP 117 >ref|XP_006441011.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] gi|557543273|gb|ESR54251.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] Length = 478 Score = 119 bits (299), Expect = 3e-29 Identities = 54/70 (77%), Positives = 58/70 (82%), Gaps = 3/70 (4%) Frame = -2 Query: 203 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 33 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 32 FKVKLWCDCP 3 FK KLWCDCP Sbjct: 108 FKAKLWCDCP 117 >ref|XP_007025023.1| Endoplasmic reticulum oxidoreductins 1 isoform 2 [Theobroma cacao] gi|508780389|gb|EOY27645.1| Endoplasmic reticulum oxidoreductins 1 isoform 2 [Theobroma cacao] Length = 372 Score = 118 bits (295), Expect = 3e-29 Identities = 50/67 (74%), Positives = 56/67 (83%) Frame = -2 Query: 203 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 24 I++ KSC CSQD KY+GIV+DCCCDYETVD LN VLHPLLQ+LV+TPFFRYFKV Sbjct: 41 ISLFGHTNKSCLCSQDKHKYSGIVQDCCCDYETVDHLNEEVLHPLLQELVKTPFFRYFKV 100 Query: 23 KLWCDCP 3 KLWCDCP Sbjct: 101 KLWCDCP 107 >ref|XP_002317004.2| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] gi|550328376|gb|EEE97616.2| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] Length = 470 Score = 119 bits (298), Expect = 4e-29 Identities = 51/68 (75%), Positives = 59/68 (86%), Gaps = 2/68 (2%) Frame = -2 Query: 200 AITSKNQKSCQC--SQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 27 ++ + N KSCQC SQDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLINSNNKSCQCPSSQDSGKYKGVIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 26 VKLWCDCP 3 VKLWCDCP Sbjct: 113 VKLWCDCP 120 >ref|XP_011036224.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Populus euphratica] Length = 482 Score = 119 bits (298), Expect = 4e-29 Identities = 52/68 (76%), Positives = 59/68 (86%), Gaps = 2/68 (2%) Frame = -2 Query: 200 AITSKNQKSCQCS--QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 27 ++ S N KSCQCS QDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLISSNYKSCQCSSAQDSGKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 26 VKLWCDCP 3 VKLWCDCP Sbjct: 113 VKLWCDCP 120 >ref|XP_002298934.2| hypothetical protein POPTR_0001s42700g [Populus trichocarpa] gi|550349635|gb|EEE83739.2| hypothetical protein POPTR_0001s42700g [Populus trichocarpa] Length = 482 Score = 119 bits (298), Expect = 4e-29 Identities = 52/68 (76%), Positives = 59/68 (86%), Gaps = 2/68 (2%) Frame = -2 Query: 200 AITSKNQKSCQCS--QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 27 ++ S N KSCQCS QDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLISSNYKSCQCSSAQDSGKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 26 VKLWCDCP 3 VKLWCDCP Sbjct: 113 VKLWCDCP 120 >ref|XP_007025022.1| Endoplasmic reticulum oxidoreductins 1 isoform 1 [Theobroma cacao] gi|508780388|gb|EOY27644.1| Endoplasmic reticulum oxidoreductins 1 isoform 1 [Theobroma cacao] Length = 466 Score = 118 bits (295), Expect = 9e-29 Identities = 50/67 (74%), Positives = 56/67 (83%) Frame = -2 Query: 203 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 24 I++ KSC CSQD KY+GIV+DCCCDYETVD LN VLHPLLQ+LV+TPFFRYFKV Sbjct: 41 ISLFGHTNKSCLCSQDKHKYSGIVQDCCCDYETVDHLNEEVLHPLLQELVKTPFFRYFKV 100 Query: 23 KLWCDCP 3 KLWCDCP Sbjct: 101 KLWCDCP 107 >ref|XP_010062721.1| PREDICTED: endoplasmic reticulum oxidoreductin-1 [Eucalyptus grandis] gi|629104385|gb|KCW69854.1| hypothetical protein EUGRSUZ_F03193 [Eucalyptus grandis] Length = 479 Score = 118 bits (295), Expect = 1e-28 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = -2 Query: 203 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 24 I ++ +SC C+Q+ +KYTG+VEDCCC+YETV+SLNG VLHPLLQ LVRTPFFRYFKV Sbjct: 47 IIVSLLTNRSCHCAQELQKYTGVVEDCCCEYETVNSLNGEVLHPLLQKLVRTPFFRYFKV 106 Query: 23 KLWCDCP 3 KLWCDCP Sbjct: 107 KLWCDCP 113