BLASTX nr result
ID: Rehmannia28_contig00015512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00015512 (409 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43177.1| hypothetical protein MIMGU_mgv1a016964mg [Erythra... 87 7e-20 >gb|EYU43177.1| hypothetical protein MIMGU_mgv1a016964mg [Erythranthe guttata] Length = 99 Score = 87.0 bits (214), Expect = 7e-20 Identities = 44/53 (83%), Positives = 47/53 (88%), Gaps = 2/53 (3%) Frame = +3 Query: 6 PLSPVSLVTSSKETTS--VAQSGLPALISHKNQTLTVTPWWRVGLVSRLFNQG 158 PL P+SL TSSKE TS V +SGLP+LISHKNQTLTVTPWWRVGLVSRLFNQG Sbjct: 47 PLPPLSLGTSSKEMTSSSVEKSGLPSLISHKNQTLTVTPWWRVGLVSRLFNQG 99