BLASTX nr result
ID: Rehmannia28_contig00015289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00015289 (321 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC70315.1| endo-1,4-beta-glucanase precursor [Glycine max] 63 1e-11 gb|AAA20083.1| CMCase; cellulase; endo-1,4-beta-D-glucanase, par... 63 3e-11 gb|KYP68274.1| Endoglucanase 23, partial [Cajanus cajan] 65 2e-10 ref|XP_015892160.1| PREDICTED: endoglucanase 24-like [Ziziphus j... 64 1e-09 gb|KHN39837.1| Endoglucanase 24 [Glycine soja] 63 1e-09 ref|XP_009631305.1| PREDICTED: endoglucanase 24-like [Nicotiana ... 63 1e-09 ref|XP_003537838.1| PREDICTED: endoglucanase 24 [Glycine max] gi... 63 1e-09 gb|KDO49895.1| hypothetical protein CISIN_1g011252mg [Citrus sin... 63 2e-09 ref|XP_006423475.1| hypothetical protein CICLE_v10028301mg [Citr... 63 2e-09 ref|XP_007042031.1| Glycosyl hydrolase 9B18 [Theobroma cacao] gi... 63 2e-09 gb|AAZ08323.1| putative endo-1,4-beta-glucanase, partial [Eucaly... 62 3e-09 dbj|BAM05588.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus g... 62 3e-09 dbj|BAM05585.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus p... 62 3e-09 ref|XP_010028647.1| PREDICTED: endoglucanase 24-like [Eucalyptus... 62 3e-09 ref|XP_010088911.1| Endoglucanase 24 [Morus notabilis] gi|587846... 62 4e-09 ref|XP_011088486.1| PREDICTED: endoglucanase 24-like [Sesamum in... 62 4e-09 ref|XP_006487371.1| PREDICTED: endoglucanase 24-like [Citrus sin... 62 4e-09 ref|XP_008236849.1| PREDICTED: endoglucanase 24-like [Prunus mume] 62 4e-09 gb|KHN33715.1| Endoglucanase 23 [Glycine soja] 62 5e-09 gb|KYP64933.1| Endoglucanase 24 [Cajanus cajan] 62 5e-09 >gb|ABC70315.1| endo-1,4-beta-glucanase precursor [Glycine max] Length = 35 Score = 63.2 bits (152), Expect = 1e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 5 RVDFRKSEPTTYINAPFVGVLAYFAANPNFS 35 >gb|AAA20083.1| CMCase; cellulase; endo-1,4-beta-D-glucanase, partial [Glycine max] Length = 74 Score = 63.2 bits (152), Expect = 3e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 44 RVDFRKSEPTTYINAPFVGVLAYFAANPNFS 74 >gb|KYP68274.1| Endoglucanase 23, partial [Cajanus cajan] Length = 256 Score = 64.7 bits (156), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 R+DFRKSEPTTYINAPFVGVLAYF ANPNVS Sbjct: 226 RIDFRKSEPTTYINAPFVGVLAYFAANPNVS 256 >ref|XP_015892160.1| PREDICTED: endoglucanase 24-like [Ziziphus jujuba] Length = 499 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 RVDFRKSEPTTYINAPFVGVLAYFVANPN Sbjct: 469 RVDFRKSEPTTYINAPFVGVLAYFVANPN 497 >gb|KHN39837.1| Endoglucanase 24 [Glycine soja] Length = 450 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 420 RVDFRKSEPTTYINAPFVGVLAYFAANPNFS 450 >ref|XP_009631305.1| PREDICTED: endoglucanase 24-like [Nicotiana tomentosiformis] Length = 494 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVG LAYF ANPN+S Sbjct: 464 RVDFRKSEPTTYINAPFVGALAYFAANPNIS 494 >ref|XP_003537838.1| PREDICTED: endoglucanase 24 [Glycine max] gi|947080564|gb|KRH29353.1| hypothetical protein GLYMA_11G111500 [Glycine max] Length = 502 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 472 RVDFRKSEPTTYINAPFVGVLAYFAANPNFS 502 >gb|KDO49895.1| hypothetical protein CISIN_1g011252mg [Citrus sinensis] Length = 490 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 460 RVDFRKSEPTTYINAPFVGVLAYFAANPNPS 490 >ref|XP_006423475.1| hypothetical protein CICLE_v10028301mg [Citrus clementina] gi|557525409|gb|ESR36715.1| hypothetical protein CICLE_v10028301mg [Citrus clementina] Length = 490 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 460 RVDFRKSEPTTYINAPFVGVLAYFAANPNPS 490 >ref|XP_007042031.1| Glycosyl hydrolase 9B18 [Theobroma cacao] gi|508705966|gb|EOX97862.1| Glycosyl hydrolase 9B18 [Theobroma cacao] Length = 498 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 468 RVDFRKSEPTTYINAPFVGVLAYFAANPNPS 498 >gb|AAZ08323.1| putative endo-1,4-beta-glucanase, partial [Eucalyptus globulus] Length = 418 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 R DFRKSEPTTYINAPFVGVLAYF ANPN+S Sbjct: 388 RADFRKSEPTTYINAPFVGVLAYFAANPNLS 418 >dbj|BAM05588.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus globulus subsp. globulus] Length = 418 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 R DFRKSEPTTYINAPFVGVLAYF ANPN+S Sbjct: 388 RADFRKSEPTTYINAPFVGVLAYFAANPNLS 418 >dbj|BAM05585.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus pilularis] gi|383081867|dbj|BAM05586.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus pilularis] gi|383081869|dbj|BAM05587.1| endo-1,4-beta-glucanase 3, partial [Eucalyptus pyrocarpa] Length = 418 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 R DFRKSEPTTYINAPFVGVLAYF ANPN+S Sbjct: 388 RADFRKSEPTTYINAPFVGVLAYFAANPNLS 418 >ref|XP_010028647.1| PREDICTED: endoglucanase 24-like [Eucalyptus grandis] gi|629089165|gb|KCW55418.1| hypothetical protein EUGRSUZ_I01325 [Eucalyptus grandis] Length = 501 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 R DFRKSEPTTYINAPFVGVLAYF ANPN+S Sbjct: 471 RADFRKSEPTTYINAPFVGVLAYFAANPNLS 501 >ref|XP_010088911.1| Endoglucanase 24 [Morus notabilis] gi|587846650|gb|EXB37115.1| Endoglucanase 24 [Morus notabilis] Length = 479 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 R DFRKSEPTTYINAPFVGVLAYFVANPN Sbjct: 450 RADFRKSEPTTYINAPFVGVLAYFVANPN 478 >ref|XP_011088486.1| PREDICTED: endoglucanase 24-like [Sesamum indicum] Length = 490 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 R DFRKSEPTTYINAPFVGVLAYFVANPN Sbjct: 461 RADFRKSEPTTYINAPFVGVLAYFVANPN 489 >ref|XP_006487371.1| PREDICTED: endoglucanase 24-like [Citrus sinensis] Length = 490 Score = 62.0 bits (149), Expect = 4e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPNVS 228 RVDFRKSEPTTYINAPFVGVLAYF ANPN S Sbjct: 460 RVDFRKSEPTTYINAPFVGVLAYFSANPNPS 490 >ref|XP_008236849.1| PREDICTED: endoglucanase 24-like [Prunus mume] Length = 499 Score = 62.0 bits (149), Expect = 4e-09 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 R DFRKSEPTTYINAPFVGVLAYFVANPN Sbjct: 469 RADFRKSEPTTYINAPFVGVLAYFVANPN 497 >gb|KHN33715.1| Endoglucanase 23 [Glycine soja] Length = 406 Score = 61.6 bits (148), Expect = 5e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 R DFRKSEPTTYINAPFVG+LAYFVANPN Sbjct: 377 RADFRKSEPTTYINAPFVGILAYFVANPN 405 >gb|KYP64933.1| Endoglucanase 24 [Cajanus cajan] Length = 481 Score = 61.6 bits (148), Expect = 5e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 320 RVDFRKSEPTTYINAPFVGVLAYFVANPN 234 R DFRKSEPTTYINAPFVG+LAYFVANPN Sbjct: 452 RADFRKSEPTTYINAPFVGILAYFVANPN 480