BLASTX nr result
ID: Rehmannia28_contig00014995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014995 (587 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098801.1| PREDICTED: isoamylase 3, chloroplastic isofo... 57 3e-06 ref|XP_011098794.1| PREDICTED: isoamylase 3, chloroplastic isofo... 57 3e-06 >ref|XP_011098801.1| PREDICTED: isoamylase 3, chloroplastic isoform X2 [Sesamum indicum] Length = 713 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 495 GKHHELDQGMIELSVDPQVNKTGDIWHICIE 587 G +++ DQGMIE+S+DPQVNKTGDIWHIC+E Sbjct: 71 GVNNKPDQGMIEISLDPQVNKTGDIWHICVE 101 >ref|XP_011098794.1| PREDICTED: isoamylase 3, chloroplastic isoform X1 [Sesamum indicum] Length = 773 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 495 GKHHELDQGMIELSVDPQVNKTGDIWHICIE 587 G +++ DQGMIE+S+DPQVNKTGDIWHIC+E Sbjct: 131 GVNNKPDQGMIEISLDPQVNKTGDIWHICVE 161