BLASTX nr result
ID: Rehmannia28_contig00014732
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014732 (535 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856274.1| PREDICTED: putative pentatricopeptide repeat... 151 9e-40 ref|XP_011072767.1| PREDICTED: putative pentatricopeptide repeat... 138 7e-35 emb|CDO97419.1| unnamed protein product [Coffea canephora] 82 3e-15 ref|XP_007011398.1| Pentatricopeptide repeat superfamily protein... 77 2e-13 ref|XP_007011397.1| Pentatricopeptide repeat superfamily protein... 77 2e-13 ref|XP_006465137.1| PREDICTED: putative pentatricopeptide repeat... 76 4e-13 gb|EPS62215.1| hypothetical protein M569_12574, partial [Genlise... 75 9e-13 gb|KDO46846.1| hypothetical protein CISIN_1g006437mg [Citrus sin... 74 2e-12 ref|XP_012460470.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-12 ref|XP_010322907.1| PREDICTED: putative pentatricopeptide repeat... 70 4e-11 ref|XP_006365279.1| PREDICTED: putative pentatricopeptide repeat... 70 4e-11 ref|XP_008227981.1| PREDICTED: putative pentatricopeptide repeat... 70 4e-11 ref|XP_015062000.1| PREDICTED: putative pentatricopeptide repeat... 70 7e-11 gb|KCW70874.1| hypothetical protein EUGRSUZ_F04004 [Eucalyptus g... 69 1e-10 ref|XP_010063636.1| PREDICTED: putative pentatricopeptide repeat... 69 1e-10 ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat... 68 3e-10 ref|XP_008788511.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 68 3e-10 ref|XP_015895881.1| PREDICTED: putative pentatricopeptide repeat... 67 6e-10 ref|XP_008342596.1| PREDICTED: putative pentatricopeptide repeat... 67 9e-10 ref|XP_015573564.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 66 2e-09 >ref|XP_012856274.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Erythranthe guttata] gi|604301620|gb|EYU21206.1| hypothetical protein MIMGU_mgv11b002092mg [Erythranthe guttata] Length = 655 Score = 151 bits (382), Expect = 9e-40 Identities = 73/106 (68%), Positives = 86/106 (81%), Gaps = 4/106 (3%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN- 131 M+WR R KFLA ITFSP KS SF+A+HHLAS + +TD+NP+ FKSFS+Q+QP+ N Sbjct: 1 MIWRLRFKFLANITFSPPKSRSFSALHHLASPLKLSTDTNPR----FKSFSNQQQPSHNP 56 Query: 130 ---FLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 FLT QIVLTTL+NCPSDL++LSFF WCARQPHYFHDKPTF HM Sbjct: 57 QPIFLTHQIVLTTLQNCPSDLVALSFFLWCARQPHYFHDKPTFRHM 102 >ref|XP_011072767.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Sesamum indicum] Length = 659 Score = 138 bits (347), Expect = 7e-35 Identities = 67/106 (63%), Positives = 79/106 (74%), Gaps = 4/106 (3%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQ----P 140 M+WR RLK AKITF P KS FAA+ HLAS I T+SNPQ P +SF ++++ P Sbjct: 1 MIWRWRLKSPAKITFCPPKSQYFAALRHLASPIKGPTNSNPQESLPSESFRNRKRLGQTP 60 Query: 139 NTNFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 FL+PQIVL TL+NC SD+I+LS FFWCARQPHYFHDKPTFHHM Sbjct: 61 KNTFLSPQIVLATLQNCSSDIIALSLFFWCARQPHYFHDKPTFHHM 106 >emb|CDO97419.1| unnamed protein product [Coffea canephora] Length = 667 Score = 82.4 bits (202), Expect = 3e-15 Identities = 46/110 (41%), Positives = 59/110 (53%), Gaps = 8/110 (7%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPT-----KSVSFAAVHHLASLINCATDSNPQNPSPF---KSFSS 152 M+WR R KF + PT KS A+H+LAS + T + F + F S Sbjct: 1 MIWRLRYKFWKALELKPTSYFLVKSQPLVAIHYLASPLQSPTTEKHKKFETFLTREEFYS 60 Query: 151 QEQPNTNFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 + N L P IV TL +C SD+++LSFF WCARQP YFHD+ F HM Sbjct: 61 KSSGNI-VLNPHIVQKTLIDCRSDVVALSFFLWCARQPDYFHDRAAFSHM 109 >ref|XP_007011398.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508728311|gb|EOY20208.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 657 Score = 77.4 bits (189), Expect = 2e-13 Identities = 46/103 (44%), Positives = 61/103 (59%), Gaps = 1/103 (0%) Frame = -1 Query: 307 MLWRRRLKFL-AKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN 131 MLWR FL +K K + F V H +S C+TD + +SFS +++ T Sbjct: 1 MLWRYNRGFLHSKPRTQILKVLPFVLVRHFSSPEVCSTDKS-------QSFSWEKRRLT- 52 Query: 130 FLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 +TPQIV +TL NCPS+LI+L FF WCA+QP+YFHD F M Sbjct: 53 -ITPQIVHSTLVNCPSNLIALGFFLWCAKQPNYFHDGEAFDCM 94 >ref|XP_007011397.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508728310|gb|EOY20207.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 695 Score = 77.4 bits (189), Expect = 2e-13 Identities = 46/103 (44%), Positives = 61/103 (59%), Gaps = 1/103 (0%) Frame = -1 Query: 307 MLWRRRLKFL-AKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN 131 MLWR FL +K K + F V H +S C+TD + +SFS +++ T Sbjct: 39 MLWRYNRGFLHSKPRTQILKVLPFVLVRHFSSPEVCSTDKS-------QSFSWEKRRLT- 90 Query: 130 FLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 +TPQIV +TL NCPS+LI+L FF WCA+QP+YFHD F M Sbjct: 91 -ITPQIVHSTLVNCPSNLIALGFFLWCAKQPNYFHDGEAFDCM 132 >ref|XP_006465137.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|568821338|ref|XP_006465138.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|568821340|ref|XP_006465139.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429660|ref|XP_015384676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429662|ref|XP_015384678.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429664|ref|XP_015384682.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429667|ref|XP_015384686.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429669|ref|XP_015384687.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] gi|985429671|ref|XP_015384692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Citrus sinensis] Length = 645 Score = 76.3 bits (186), Expect = 4e-13 Identities = 46/104 (44%), Positives = 59/104 (56%), Gaps = 2/104 (1%) Frame = -1 Query: 307 MLWR--RRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNT 134 MLWR R L + A+ T +SF ++H ++S CAT + Q+ P Sbjct: 1 MLWRCKRSLFYTAQRTQILKTIISFKSIHQISSPKVCAT-------------THQDFPI- 46 Query: 133 NFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 L PQIV +TL NCPSDLI+LSFF WCA+Q YFHD +F HM Sbjct: 47 -ILAPQIVHSTLLNCPSDLIALSFFIWCAKQRDYFHDVQSFDHM 89 >gb|EPS62215.1| hypothetical protein M569_12574, partial [Genlisea aurea] Length = 450 Score = 75.1 bits (183), Expect = 9e-13 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 127 LTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 LT + VLT L CPSDL +LSFF WCARQPHYFH+KP FHHM Sbjct: 1 LTHKFVLTALHCCPSDLAALSFFLWCARQPHYFHEKPAFHHM 42 >gb|KDO46846.1| hypothetical protein CISIN_1g006437mg [Citrus sinensis] Length = 645 Score = 74.3 bits (181), Expect = 2e-12 Identities = 45/104 (43%), Positives = 58/104 (55%), Gaps = 2/104 (1%) Frame = -1 Query: 307 MLWR--RRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNT 134 MLWR R L + A+ T +SF ++H ++S CAT + Q+ P Sbjct: 1 MLWRCKRSLFYTAQRTQILKTIISFKSIHQISSPKVCAT-------------THQDFPI- 46 Query: 133 NFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 L P IV +TL NCPSDLI+LSFF WCA+Q YFHD +F HM Sbjct: 47 -ILAPHIVHSTLLNCPSDLIALSFFIWCAKQRDYFHDVQSFDHM 89 >ref|XP_012460470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255629|ref|XP_012460471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255631|ref|XP_012460473.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255633|ref|XP_012460474.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255635|ref|XP_012460475.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255637|ref|XP_012460476.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255639|ref|XP_012460477.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|823255641|ref|XP_012460478.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Gossypium raimondii] gi|763807993|gb|KJB74895.1| hypothetical protein B456_012G013300 [Gossypium raimondii] Length = 653 Score = 73.9 bits (180), Expect = 3e-12 Identities = 43/102 (42%), Positives = 55/102 (53%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTNF 128 M+WR R FL S A+ LI+ S P+ S KS + + T Sbjct: 1 MIWRCRWGFLP--------STPATAIFASFRLISVRLFSAPEVSSTDKSQAFSGEKKTLI 52 Query: 127 LTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 + PQIV +TL NCPS+LI+LSFF WCA+QP+YFHD F M Sbjct: 53 INPQIVHSTLLNCPSNLIALSFFLWCAKQPNYFHDVQAFDCM 94 >ref|XP_010322907.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658953|ref|XP_010322909.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658956|ref|XP_010322912.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658959|ref|XP_010322917.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658962|ref|XP_010322925.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658965|ref|XP_010322928.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658968|ref|XP_010322932.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658971|ref|XP_010322937.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] gi|723658974|ref|XP_010322940.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 isoform X1 [Solanum lycopersicum] Length = 657 Score = 70.5 bits (171), Expect = 4e-11 Identities = 35/80 (43%), Positives = 46/80 (57%) Frame = -1 Query: 253 KSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTNFLTPQIVLTTLRNCPSDLI 74 K S A+ L S I C D+ PQ + + + LTP IV TT+ NC SD++ Sbjct: 18 KMESLASFRSLCSQIQCFADT-PQGSFSCSHYQKIPENSRIILTPTIVHTTISNCHSDIL 76 Query: 73 SLSFFFWCARQPHYFHDKPT 14 + SFF WCARQP+YFHD+ T Sbjct: 77 AFSFFLWCARQPNYFHDRGT 96 >ref|XP_006365279.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Solanum tuberosum] Length = 657 Score = 70.5 bits (171), Expect = 4e-11 Identities = 35/78 (44%), Positives = 46/78 (58%) Frame = -1 Query: 253 KSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTNFLTPQIVLTTLRNCPSDLI 74 K S A+ L S I C D+ PQ + + + LTP+IV TTL NC SD++ Sbjct: 18 KMESLASFRSLCSQIQCFADT-PQGSFSSRHYQKFPENPRIILTPRIVHTTLSNCRSDIL 76 Query: 73 SLSFFFWCARQPHYFHDK 20 + SFF WCARQP+YFHD+ Sbjct: 77 AFSFFLWCARQPNYFHDR 94 >ref|XP_008227981.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Prunus mume] Length = 663 Score = 70.5 bits (171), Expect = 4e-11 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = -1 Query: 310 EMLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN 131 E +WR RL FL K +++ + H +S C T+ K F P + Sbjct: 2 EKVWRFRLCFLHKGPNQIIRALRMLPICHFSSPKVCPTNKTK------KIFQENLDPERS 55 Query: 130 --FLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 LT Q V +TL NCPSDLI+L FF WCA+QP++FH++ F HM Sbjct: 56 KCTLTHQNVHSTLLNCPSDLIALRFFLWCAQQPNFFHNRIVFDHM 100 >ref|XP_015062000.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Solanum pennellii] gi|969996219|ref|XP_015062007.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Solanum pennellii] gi|969996221|ref|XP_015062015.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Solanum pennellii] Length = 657 Score = 69.7 bits (169), Expect = 7e-11 Identities = 35/80 (43%), Positives = 45/80 (56%) Frame = -1 Query: 253 KSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTNFLTPQIVLTTLRNCPSDLI 74 K S A+ L S I C D+ PQ + + LTP IV TT+ NC SD++ Sbjct: 18 KMESLASFRSLCSQIQCFADT-PQGSFSSSHYQKFPENPRIILTPTIVRTTISNCRSDIL 76 Query: 73 SLSFFFWCARQPHYFHDKPT 14 + SFF WCARQP+YFHD+ T Sbjct: 77 AFSFFLWCARQPNYFHDRGT 96 >gb|KCW70874.1| hypothetical protein EUGRSUZ_F04004 [Eucalyptus grandis] Length = 642 Score = 68.9 bits (167), Expect = 1e-10 Identities = 42/115 (36%), Positives = 59/115 (51%), Gaps = 13/115 (11%) Frame = -1 Query: 307 MLWR--------RRLKFLAKITFS-----PTKSVSFAAVHHLASLINCATDSNPQNPSPF 167 MLWR R++ L ++ S P S + A+ S+ T S+ +N Sbjct: 1 MLWRFPWTSRRCARIRALPRLHSSSLAGLPLPSPAPASAPARPSIRRAHTTSSRENRRRI 60 Query: 166 KSFSSQEQPNTNFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 + F +P LTP +V +TL +CPSDLI+L FF WCA QP YFHD+ +F M Sbjct: 61 RRFPGINKP---LLTPDVVRSTLSSCPSDLIALRFFLWCAEQPDYFHDRGSFDRM 112 >ref|XP_010063636.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Eucalyptus grandis] gi|702381291|ref|XP_010063637.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Eucalyptus grandis] Length = 675 Score = 68.9 bits (167), Expect = 1e-10 Identities = 42/115 (36%), Positives = 59/115 (51%), Gaps = 13/115 (11%) Frame = -1 Query: 307 MLWR--------RRLKFLAKITFS-----PTKSVSFAAVHHLASLINCATDSNPQNPSPF 167 MLWR R++ L ++ S P S + A+ S+ T S+ +N Sbjct: 1 MLWRFPWTSRRCARIRALPRLHSSSLAGLPLPSPAPASAPARPSIRRAHTTSSRENRRRI 60 Query: 166 KSFSSQEQPNTNFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 + F +P LTP +V +TL +CPSDLI+L FF WCA QP YFHD+ +F M Sbjct: 61 RRFPGINKP---LLTPDVVRSTLSSCPSDLIALRFFLWCAEQPDYFHDRGSFDRM 112 >ref|XP_002267486.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vitis vinifera] gi|731403962|ref|XP_010655265.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Vitis vinifera] gi|297735747|emb|CBI18434.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 68.2 bits (165), Expect = 3e-10 Identities = 36/79 (45%), Positives = 45/79 (56%), Gaps = 16/79 (20%) Frame = -1 Query: 190 NPQNPSPFKSFSSQEQP--------NTNF--------LTPQIVLTTLRNCPSDLISLSFF 59 NP+ PS FS P N NF LT Q++ +TL NCPSDLI+LSFF Sbjct: 17 NPKTPSLTPLFSLSNHPQNPKFTRENHNFPEKKPGLVLTDQLLESTLLNCPSDLIALSFF 76 Query: 58 FWCARQPHYFHDKPTFHHM 2 WCA+QP++FH + F HM Sbjct: 77 LWCAKQPNFFHHRRAFDHM 95 >ref|XP_008788511.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g16830 [Phoenix dactylifera] Length = 638 Score = 67.8 bits (164), Expect = 3e-10 Identities = 33/74 (44%), Positives = 46/74 (62%) Frame = -1 Query: 223 LASLINCATDSNPQNPSPFKSFSSQEQPNTNFLTPQIVLTTLRNCPSDLISLSFFFWCAR 44 + +I +S+ QNP S + E + L PQ+V +T+ +CPSD I+LSFF WCAR Sbjct: 1 MEKIIRSYLESDIQNPKKSXSNNCLESSKLH-LCPQVVESTVLSCPSDTIALSFFLWCAR 59 Query: 43 QPHYFHDKPTFHHM 2 QP+YFHD +F M Sbjct: 60 QPNYFHDPRSFDRM 73 >ref|XP_015895881.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Ziziphus jujuba] Length = 662 Score = 67.0 bits (162), Expect = 6e-10 Identities = 40/110 (36%), Positives = 58/110 (52%), Gaps = 8/110 (7%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPTKSVS-FAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN 131 M+WR R L P + ++ ++H+L S C T ++ +E T+ Sbjct: 1 MVWRYRWSLLC---LRPNRIITVMPSIHYLPSRTACITYKTQKDV--------RESLGTD 49 Query: 130 F-------LTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 F LT Q V +TL NCPSDL +LSFF WCA+QP++FHD F++M Sbjct: 50 FYKKSRITLTHQAVYSTLLNCPSDLSALSFFLWCAKQPNFFHDHLAFNYM 99 >ref|XP_008342596.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014561|ref|XP_008342597.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014563|ref|XP_008342599.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014565|ref|XP_008342600.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014567|ref|XP_008342601.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] gi|658014569|ref|XP_008342602.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g16830 [Malus domestica] Length = 661 Score = 66.6 bits (161), Expect = 9e-10 Identities = 36/103 (34%), Positives = 53/103 (51%) Frame = -1 Query: 310 EMLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINCATDSNPQNPSPFKSFSSQEQPNTN 131 E++WR R F+ + +++ + H +S C T+ +N F T+ Sbjct: 2 EIVWRFRYCFVPRGPTQIIRALRMLPICHFSSPKMCPTNKTQEN------FPKLFDRQTS 55 Query: 130 FLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 L Q+V +TL NCPSDLI+L FF WCA Q ++FH K HM Sbjct: 56 KLNHQVVHSTLLNCPSDLIALRFFLWCAGQHNFFHSKIVIDHM 98 >ref|XP_015573564.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g16830 [Ricinus communis] Length = 600 Score = 65.9 bits (159), Expect = 2e-09 Identities = 43/105 (40%), Positives = 53/105 (50%), Gaps = 3/105 (2%) Frame = -1 Query: 307 MLWRRRLKFLAKITFSPTKSVSFAAVHHLASLINC---ATDSNPQNPSPFKSFSSQEQPN 137 M WR + L I T+ + ++ H +S ATD Q F S E Sbjct: 1 MSWRYKWSSLHIIR--KTQILKSRSLRHFSSSSTVCLHATDKTHQ-------FVSGENVK 51 Query: 136 TNFLTPQIVLTTLRNCPSDLISLSFFFWCARQPHYFHDKPTFHHM 2 LTPQIV +TL NC SDLI+LSFF WCA+Q +YFH F HM Sbjct: 52 KVTLTPQIVHSTLLNCSSDLITLSFFIWCAKQNNYFHSNQAFDHM 96