BLASTX nr result
ID: Rehmannia28_contig00014517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014517 (397 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072739.1| PREDICTED: metal tolerance protein C4 isofor... 57 5e-07 ref|XP_011072738.1| PREDICTED: metal tolerance protein C4 isofor... 57 5e-07 >ref|XP_011072739.1| PREDICTED: metal tolerance protein C4 isoform X2 [Sesamum indicum] Length = 433 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 264 YNFSPFSCSIAQIHAPLSLSEPENRNLQENKFVNRKLILQYDI 392 Y++SPFSC I QIH ++PEN NLQENKF+N +L YDI Sbjct: 15 YHYSPFSCFIPQIHISYPSTDPENPNLQENKFINHPRLLLYDI 57 >ref|XP_011072738.1| PREDICTED: metal tolerance protein C4 isoform X1 [Sesamum indicum] Length = 465 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 264 YNFSPFSCSIAQIHAPLSLSEPENRNLQENKFVNRKLILQYDI 392 Y++SPFSC I QIH ++PEN NLQENKF+N +L YDI Sbjct: 15 YHYSPFSCFIPQIHISYPSTDPENPNLQENKFINHPRLLLYDI 57