BLASTX nr result
ID: Rehmannia28_contig00014515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00014515 (339 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072739.1| PREDICTED: metal tolerance protein C4 isofor... 59 7e-08 ref|XP_011072738.1| PREDICTED: metal tolerance protein C4 isofor... 59 8e-08 ref|XP_012856343.1| PREDICTED: metal tolerance protein C4 [Eryth... 56 5e-07 >ref|XP_011072739.1| PREDICTED: metal tolerance protein C4 isoform X2 [Sesamum indicum] Length = 433 Score = 58.5 bits (140), Expect = 7e-08 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 127 YNFSPFSCSIAQIHAPFSSSEPENRNLQENKFVNCKSILQYD 2 Y++SPFSC I QIH + S++PEN NLQENKF+N +L YD Sbjct: 15 YHYSPFSCFIPQIHISYPSTDPENPNLQENKFINHPRLLLYD 56 >ref|XP_011072738.1| PREDICTED: metal tolerance protein C4 isoform X1 [Sesamum indicum] Length = 465 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 127 YNFSPFSCSIAQIHAPFSSSEPENRNLQENKFVNCKSILQYD 2 Y++SPFSC I QIH + S++PEN NLQENKF+N +L YD Sbjct: 15 YHYSPFSCFIPQIHISYPSTDPENPNLQENKFINHPRLLLYD 56 >ref|XP_012856343.1| PREDICTED: metal tolerance protein C4 [Erythranthe guttata] gi|604301633|gb|EYU21219.1| hypothetical protein MIMGU_mgv1a005898mg [Erythranthe guttata] Length = 466 Score = 56.2 bits (134), Expect = 5e-07 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -3 Query: 127 YNFSPFSCSIAQIHAPFSSSEPENRNLQENKFVNCKSILQYD 2 YN+S FSCSI++IH PF S EP+N +LQ+NK N +IL++D Sbjct: 15 YNYSQFSCSISRIHTPFPSHEPDNPDLQDNKLSNHPNILRHD 56