BLASTX nr result
ID: Rehmannia28_contig00013874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013874 (385 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078849.1| PREDICTED: Golgi to ER traffic protein 4 hom... 59 8e-08 ref|XP_012830793.1| PREDICTED: Golgi to ER traffic protein 4 hom... 58 2e-07 ref|XP_015877180.1| PREDICTED: Golgi to ER traffic protein 4 hom... 56 9e-07 ref|XP_015877179.1| PREDICTED: Golgi to ER traffic protein 4 hom... 56 1e-06 ref|XP_010108451.1| hypothetical protein L484_014122 [Morus nota... 54 3e-06 emb|CDP19077.1| unnamed protein product [Coffea canephora] 54 6e-06 gb|KJB78901.1| hypothetical protein B456_013G025000 [Gossypium r... 54 7e-06 ref|XP_002278274.1| PREDICTED: Golgi to ER traffic protein 4 hom... 53 9e-06 >ref|XP_011078849.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042493|ref|XP_011078857.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042495|ref|XP_011078864.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042497|ref|XP_011078872.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042499|ref|XP_011078881.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042501|ref|XP_011078889.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] gi|747042503|ref|XP_011078898.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Sesamum indicum] Length = 326 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVIT 292 ELLDEVAEKFYGV+RRN+MPGMFG+IFK+I+ Sbjct: 294 ELLDEVAEKFYGVQRRNAMPGMFGDIFKMIS 324 >ref|XP_012830793.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Erythranthe guttata] gi|848859845|ref|XP_012830794.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Erythranthe guttata] gi|604343907|gb|EYU42724.1| hypothetical protein MIMGU_mgv1a009970mg [Erythranthe guttata] Length = 326 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVIT 292 ELLDEVAEKFYGV+RRN MPGMFGE+FK+++ Sbjct: 294 ELLDEVAEKFYGVQRRNQMPGMFGELFKMMS 324 >ref|XP_015877180.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X2 [Ziziphus jujuba] Length = 288 Score = 55.8 bits (133), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVI 295 ELLDE+AEKFYGVRRRN M GMFGEIFK++ Sbjct: 255 ELLDEIAEKFYGVRRRNPMQGMFGEIFKMM 284 >ref|XP_015877179.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X1 [Ziziphus jujuba] Length = 326 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVI 295 ELLDE+AEKFYGVRRRN M GMFGEIFK++ Sbjct: 293 ELLDEIAEKFYGVRRRNPMQGMFGEIFKMM 322 >ref|XP_010108451.1| hypothetical protein L484_014122 [Morus notabilis] gi|587932438|gb|EXC19492.1| hypothetical protein L484_014122 [Morus notabilis] Length = 339 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKV 298 ELLDE+AEKFYGVRRRN + GMFGEIFK+ Sbjct: 292 ELLDEIAEKFYGVRRRNPLQGMFGEIFKL 320 >emb|CDP19077.1| unnamed protein product [Coffea canephora] Length = 326 Score = 53.5 bits (127), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVI 295 ELLDE+AEKFYGVRRRN + GMFG+IFK++ Sbjct: 294 ELLDEIAEKFYGVRRRNPLQGMFGDIFKMM 323 >gb|KJB78901.1| hypothetical protein B456_013G025000 [Gossypium raimondii] Length = 367 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVI 295 ELLDE+AEKFYGV+RRN + GMFG++FKVI Sbjct: 292 ELLDEIAEKFYGVQRRNPLQGMFGDLFKVI 321 >ref|XP_002278274.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X2 [Vitis vinifera] Length = 322 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 384 ELLDEVAEKFYGVRRRNSMPGMFGEIFKVI 295 ELLDE+AEKFYGVRRRN M GMFG+ FK++ Sbjct: 292 ELLDEIAEKFYGVRRRNPMQGMFGDFFKLM 321