BLASTX nr result
ID: Rehmannia28_contig00013597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013597 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKC43539.1| radialis [Rhytidophyllum auriculatum] 50 1e-07 gb|AKC43540.1| radialis [Rhytidophyllum rupincola] 49 9e-07 ref|XP_011088399.1| PREDICTED: transcription factor RADIALIS-lik... 52 1e-06 ref|XP_015061756.1| PREDICTED: transcription factor RADIALIS [So... 51 5e-06 ref|XP_004231423.1| PREDICTED: transcription factor RADIALIS [So... 51 5e-06 >gb|AKC43539.1| radialis [Rhytidophyllum auriculatum] Length = 100 Score = 49.7 bits (117), Expect(2) = 1e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 72 SMAQGTGSSRTWTAQENKAFEKALAVFDQDTP 167 SM + +GS TWTA+ENKAFEKALAVFD+DTP Sbjct: 5 SMTRNSGS--TWTAKENKAFEKALAVFDKDTP 34 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +1 Query: 175 ESGKVPFPKYRTTXXXXXXXIKR*NPRTRNL 267 ESG+VPFP YRTT I+ R RNL Sbjct: 67 ESGRVPFPNYRTTGTNHVANIRDEEQRMRNL 97 >gb|AKC43540.1| radialis [Rhytidophyllum rupincola] Length = 100 Score = 48.5 bits (114), Expect(2) = 9e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 72 SMAQGTGSSRTWTAQENKAFEKALAVFDQDTP 167 SM + +G TWTA+ENKAFEKALAVFD+DTP Sbjct: 5 SMTRNSGG--TWTAKENKAFEKALAVFDEDTP 34 Score = 31.2 bits (69), Expect(2) = 9e-07 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 175 ESGKVPFPKYRTTXXXXXXXIKR*NPRTRNL 267 ESG+VPFP YRT I+ R RNL Sbjct: 67 ESGRVPFPNYRTAGTNHVANIRDEEQRMRNL 97 >ref|XP_011088399.1| PREDICTED: transcription factor RADIALIS-like [Sesamum indicum] Length = 79 Score = 52.0 bits (123), Expect = 1e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 72 SMAQGTGSSRTWTAQENKAFEKALAVFDQDTP 167 SM++G GS TWTAQENKAFE+ALA+FD+DTP Sbjct: 5 SMSRGAGS--TWTAQENKAFERALAIFDKDTP 34 >ref|XP_015061756.1| PREDICTED: transcription factor RADIALIS [Solanum pennellii] Length = 90 Score = 50.8 bits (120), Expect = 5e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +3 Query: 84 GTGSSRTWTAQENKAFEKALAVFDQDTP 167 G GSS TWTAQ+NKAFE+ALAV+D+DTP Sbjct: 7 GQGSSVTWTAQQNKAFERALAVYDKDTP 34 >ref|XP_004231423.1| PREDICTED: transcription factor RADIALIS [Solanum lycopersicum] Length = 90 Score = 50.8 bits (120), Expect = 5e-06 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +3 Query: 84 GTGSSRTWTAQENKAFEKALAVFDQDTP 167 G GSS TWTAQ+NKAFE+ALAV+D+DTP Sbjct: 7 GQGSSVTWTAQQNKAFERALAVYDKDTP 34