BLASTX nr result
ID: Rehmannia28_contig00013551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013551 (336 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphat... 62 5e-09 ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphat... 58 1e-07 >ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] gi|747072128|ref|XP_011082964.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] Length = 500 Score = 62.0 bits (149), Expect = 5e-09 Identities = 33/59 (55%), Positives = 35/59 (59%) Frame = +1 Query: 160 ITNKDKRQGIRREPSFSGWCDEDGIPRPARLTXXXXXXXXXXXXLPLVQPQRPENKVLD 336 +T +DK I REPSFSGW DEDGIP PARL L LVQPQ EN VLD Sbjct: 20 LTREDKSVRISREPSFSGWFDEDGIPLPARLRNDEVNEEDFVFRLHLVQPQGSENGVLD 78 >ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888228|ref|XP_012844323.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888231|ref|XP_012844324.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|604320855|gb|EYU31629.1| hypothetical protein MIMGU_mgv1a005699mg [Erythranthe guttata] Length = 474 Score = 58.2 bits (139), Expect = 1e-07 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +1 Query: 166 NKDKRQGIRREPSFSGWCDEDGIPRPARLTXXXXXXXXXXXXLPLVQPQRPENKVLD 336 +K KR GIRREPSFSGW DEDGIP P++L LPL Q + EN LD Sbjct: 15 SKVKRIGIRREPSFSGWYDEDGIPYPSQLINDEVNVEEFDFNLPLAQTRSSENDSLD 71