BLASTX nr result
ID: Rehmannia28_contig00013509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00013509 (589 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091054.1| PREDICTED: protein DOS2-like [Sesamum indicum] 118 4e-28 ref|XP_012827864.1| PREDICTED: protein DOS2-like [Erythranthe gu... 99 5e-21 ref|XP_012092304.1| PREDICTED: BSD domain-containing protein 1 [... 57 2e-06 ref|XP_009769832.1| PREDICTED: BSD domain-containing protein 1-l... 56 6e-06 ref|XP_009609401.1| PREDICTED: BSD domain-containing protein 1-l... 55 8e-06 >ref|XP_011091054.1| PREDICTED: protein DOS2-like [Sesamum indicum] Length = 423 Score = 118 bits (295), Expect = 4e-28 Identities = 62/92 (67%), Positives = 70/92 (76%) Frame = -2 Query: 588 EDVGVSGTKSDDVVVDEENLGERLIYNEKEVSDGKIGXXXXXXXXXXXSHAEDDLGWDEI 409 ED GVSGTKS D++ DEENL ERL NEKE S+GK+G SHAEDDLGWDEI Sbjct: 314 EDAGVSGTKSVDLI-DEENLEERLTCNEKEGSEGKLGSDISVISSQRSSHAEDDLGWDEI 372 Query: 408 EDIGSGDESKVSHHGSPSPSNVIDLQKRLSSA 313 EDIGSGDESK+ H SPSPSN +DL+KRLS+A Sbjct: 373 EDIGSGDESKLGEHRSPSPSNGVDLRKRLSAA 404 >ref|XP_012827864.1| PREDICTED: protein DOS2-like [Erythranthe guttata] gi|604345270|gb|EYU43852.1| hypothetical protein MIMGU_mgv1a018969mg [Erythranthe guttata] Length = 409 Score = 98.6 bits (244), Expect = 5e-21 Identities = 59/94 (62%), Positives = 67/94 (71%), Gaps = 2/94 (2%) Frame = -2 Query: 588 EDVGVSGTKSDDVVVDEENLGERLIYNEKEVS-DGKIGXXXXXXXXXXXSHAEDDLGWDE 412 E VGVSGT S V+VD++NLGE LI NEKEVS +GKIG SHAEDDLGWDE Sbjct: 296 EGVGVSGTNSG-VLVDDDNLGEGLICNEKEVSSEGKIGSDISIISSQRSSHAEDDLGWDE 354 Query: 411 IEDIGSGDESKVSHHGS-PSPSNVIDLQKRLSSA 313 IEDIGSGDESK++ GS + S+ IDL KR S A Sbjct: 355 IEDIGSGDESKITERGSHKNTSSEIDLAKRPSGA 388 >ref|XP_012092304.1| PREDICTED: BSD domain-containing protein 1 [Jatropha curcas] gi|643704447|gb|KDP21511.1| hypothetical protein JCGZ_21982 [Jatropha curcas] Length = 420 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 435 EDDLGWDEIEDIGSGDESKVSHHGSPSPSNVIDLQKRLSSA 313 E+DLGWDEIED+ S DE KVSH GSP N +DL+KRLS+A Sbjct: 364 EEDLGWDEIEDLSSIDEKKVSHSGSP---NKVDLRKRLSAA 401 >ref|XP_009769832.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana sylvestris] Length = 438 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -2 Query: 441 HAEDDLGWDEIEDIGSGDESKVSHHGSPSPSNVIDLQKRLSSA 313 H DDLGWDEIEDIGSGDE KV SPS S DL+KRL++A Sbjct: 380 HEGDDLGWDEIEDIGSGDEIKVPERMSPSKS---DLRKRLTAA 419 >ref|XP_009609401.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 440 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -2 Query: 441 HAEDDLGWDEIEDIGSGDESKVSHHGSPSPSNVIDLQKRLSSA 313 H DDLGWDEIEDIGSGDE KV SPS S DL+KRL++A Sbjct: 382 HEGDDLGWDEIEDIGSGDEIKVPDRMSPSKS---DLRKRLTAA 421