BLASTX nr result
ID: Rehmannia28_contig00012856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012856 (418 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847755.1| PREDICTED: uncharacterized protein LOC105967... 89 2e-18 ref|XP_011070966.1| PREDICTED: uncharacterized protein LOC105156... 80 4e-15 gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlise... 61 3e-08 >ref|XP_012847755.1| PREDICTED: uncharacterized protein LOC105967684 [Erythranthe guttata] gi|604316628|gb|EYU28820.1| hypothetical protein MIMGU_mgv1a008353mg [Erythranthe guttata] Length = 376 Score = 89.4 bits (220), Expect = 2e-18 Identities = 48/68 (70%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 220 MGRWRAPLIVSRIISASKSINNLNFHKAPSLRSQNSPLISKPRDYFSNFRSFSALPSVSP 399 MGRWRA LIV+RI+SASKSINNLN + P LRS S LIS+ R+YF NFRSFSALPSV P Sbjct: 1 MGRWRASLIVARIVSASKSINNLNINHNPPLRSPYSLLISERRNYFLNFRSFSALPSVFP 60 Query: 400 --LEEFDF 417 EEFD+ Sbjct: 61 RDAEEFDY 68 >ref|XP_011070966.1| PREDICTED: uncharacterized protein LOC105156512 [Sesamum indicum] Length = 376 Score = 80.1 bits (196), Expect = 4e-15 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 2/67 (2%) Frame = +1 Query: 220 MGRWRAPLIVSRIISASKSINNLNFHKAPSLRSQNSPLISKPRDYFSNFRSFSALPSVSP 399 MGRWRA LI+SR+I +KSINN P RS SPLIS+PR+YF NFRSFSALPS SP Sbjct: 1 MGRWRASLIISRVILVTKSINNPYISPNPFPRSPISPLISEPRNYFLNFRSFSALPSPSP 60 Query: 400 --LEEFD 414 E+FD Sbjct: 61 HYAEDFD 67 >gb|EPS66903.1| hypothetical protein M569_07873, partial [Genlisea aurea] Length = 381 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = +1 Query: 220 MGRWRAPLIVSRIISASKSINNLNFHKAPSLRSQNSPLISKPRDYFSNFRSFSALPSVSP 399 MGRWR P+I+ I+ ASKSI NLN + +S + ++ +PR + SN R FSALPS SP Sbjct: 1 MGRWRTPVILDHILRASKSIGNLNSSRNACPKSLFASIVLQPRIFLSNLRWFSALPSPSP 60