BLASTX nr result
ID: Rehmannia28_contig00012731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012731 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078155.1| PREDICTED: vegetative cell wall protein gp1-... 63 2e-10 >ref|XP_011078155.1| PREDICTED: vegetative cell wall protein gp1-like [Sesamum indicum] Length = 139 Score = 63.2 bits (152), Expect = 2e-10 Identities = 37/93 (39%), Positives = 42/93 (45%) Frame = +2 Query: 74 MASNLQYLLSTIVFLSTTLHFPATTTAQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 253 MAS L LLST++FLST L +P TT QE Sbjct: 1 MASTLHMLLSTLLFLSTILEYPVPTTPQEECPYPCYPPPTGPGNNPPLSTTPPVSTLPPP 60 Query: 254 XXXFSGPPVSTAPPAGIFPFTPTPPYFSGVTPP 352 PVST+PPAG+FPFTP PYF G PP Sbjct: 61 ------APVSTSPPAGVFPFTPPSPYFYGAVPP 87