BLASTX nr result
ID: Rehmannia28_contig00012715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012715 (426 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847582.1| PREDICTED: neurofilament medium polypeptide ... 57 5e-07 >ref|XP_012847582.1| PREDICTED: neurofilament medium polypeptide [Erythranthe guttata] gi|848895088|ref|XP_012847583.1| PREDICTED: neurofilament medium polypeptide [Erythranthe guttata] gi|848895090|ref|XP_012847584.1| PREDICTED: neurofilament medium polypeptide [Erythranthe guttata] gi|604316464|gb|EYU28656.1| hypothetical protein MIMGU_mgv1a0052221mg [Erythranthe guttata] Length = 493 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 3 FLKKLEAKSIAREAANAQLSAKSRAGITNEIHQRPTLSR 119 FLKKLEAKSI REA NAQL+AKS+ G+ N QRPTLSR Sbjct: 455 FLKKLEAKSIIREAENAQLTAKSKVGMENGTRQRPTLSR 493