BLASTX nr result
ID: Rehmannia28_contig00012528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012528 (345 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087456.1| PREDICTED: exonuclease DPD1, chloroplastic/m... 63 2e-09 gb|EYU37251.1| hypothetical protein MIMGU_mgv1a012596mg [Erythra... 57 2e-07 ref|XP_012837692.1| PREDICTED: exonuclease DPD1, chloroplastic/m... 57 4e-07 >ref|XP_011087456.1| PREDICTED: exonuclease DPD1, chloroplastic/mitochondrial [Sesamum indicum] Length = 343 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 245 MKTIAMCFSLLQFPRCRIHSLGNSLWESVYKLG 343 MKTI MCFSLLQFPRCRIHSL NS WES +KLG Sbjct: 1 MKTIVMCFSLLQFPRCRIHSLANSWWESFHKLG 33 >gb|EYU37251.1| hypothetical protein MIMGU_mgv1a012596mg [Erythranthe guttata] Length = 245 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 245 MKTIAMCFSLLQFPRCRIHSLGNSLWESVYKLG 343 MK IAMCFSLLQFPRCRIHSL NS +E+ KLG Sbjct: 1 MKAIAMCFSLLQFPRCRIHSLANSCFENFNKLG 33 >ref|XP_012837692.1| PREDICTED: exonuclease DPD1, chloroplastic/mitochondrial [Erythranthe guttata] Length = 350 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 245 MKTIAMCFSLLQFPRCRIHSLGNSLWESVYKLG 343 MK IAMCFSLLQFPRCRIHSL NS +E+ KLG Sbjct: 1 MKAIAMCFSLLQFPRCRIHSLANSCFENFNKLG 33