BLASTX nr result
ID: Rehmannia28_contig00012381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012381 (324 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074120.1| PREDICTED: eukaryotic translation initiation... 65 3e-10 ref|XP_012838933.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic t... 58 1e-07 >ref|XP_011074120.1| PREDICTED: eukaryotic translation initiation factor 5B [Sesamum indicum] Length = 1325 Score = 65.5 bits (158), Expect = 3e-10 Identities = 35/54 (64%), Positives = 36/54 (66%) Frame = +3 Query: 3 GRKKPTAVDEESXXXXXXXXXXXXXXXXXIADDEYSIGTELSEDAVVPEEKVAP 164 GRKKPTA DEE+ IADDEYSIGTELSEDAVVPEEKVAP Sbjct: 2 GRKKPTARDEETAPAGGGGGGKSKKKGFVIADDEYSIGTELSEDAVVPEEKVAP 55 >ref|XP_012838933.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 5B-like [Erythranthe guttata] Length = 1278 Score = 57.8 bits (138), Expect = 1e-07 Identities = 31/54 (57%), Positives = 34/54 (62%) Frame = +3 Query: 3 GRKKPTAVDEESXXXXXXXXXXXXXXXXXIADDEYSIGTELSEDAVVPEEKVAP 164 GRKKP+ DEES I DDEYS+GTELSE+AVVPEEKVAP Sbjct: 2 GRKKPSNRDEESGPTGVAAGGKSKKKGFMIDDDEYSMGTELSEEAVVPEEKVAP 55