BLASTX nr result
ID: Rehmannia28_contig00012178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00012178 (403 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083108.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 ... 57 3e-07 >ref|XP_011083108.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 [Sesamum indicum] Length = 313 Score = 57.4 bits (137), Expect = 3e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 SERKHLQSFITQAREQLAEVENMYENLRSTQNRTNGG 111 SERKHLQS I QAR+QL EVEN E+LRST+NRTN G Sbjct: 89 SERKHLQSCIAQARDQLGEVENQSEDLRSTENRTNRG 125