BLASTX nr result
ID: Rehmannia28_contig00011619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011619 (945 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJE29370.1| putative gag protein [Coffea canephora] 55 1e-08 >gb|AJE29370.1| putative gag protein [Coffea canephora] Length = 433 Score = 54.7 bits (130), Expect(2) = 1e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -1 Query: 774 ILDSGCVMHVYSRRNYFDLLQLQRAGILFSGDGSTCRI 661 ILDSGCV HV SR +YFD LQ ++AG + GDGSTC++ Sbjct: 284 ILDSGCVSHVCSRLDYFDTLQRKKAGFMCLGDGSTCQV 321 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 920 GVVCYRYHEEGHFKRNCPRRKK 855 G+ C+ HE GH KR CP +KK Sbjct: 229 GIQCFGCHEFGHIKRYCPHQKK 250