BLASTX nr result
ID: Rehmannia28_contig00011491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011491 (310 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035057.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 56 3e-07 ref|XP_006354516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 53 4e-06 >ref|XP_007035057.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative [Theobroma cacao] gi|508714086|gb|EOY05983.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative [Theobroma cacao] Length = 371 Score = 56.2 bits (134), Expect = 3e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +2 Query: 194 MVLTENGIVQAANKSEYDRNSEIKAFDDTKAGVKGLMEA 310 MV+ G VQ +K EYDR SE+KAFDDTKAGVKGL++A Sbjct: 1 MVIANTGEVQTTSKPEYDRASEVKAFDDTKAGVKGLVDA 39 >ref|XP_006354516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog [Solanum tuberosum] Length = 382 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +2 Query: 185 EEKMVLTENGIVQAANKSEYDRNSEIKAFDDTKAGVKGLMEA 310 EEKMV + + QA + YD++SE+KAFDDTKAGVKGL++A Sbjct: 5 EEKMVFSRDEEFQATLQPNYDKHSELKAFDDTKAGVKGLVDA 46