BLASTX nr result
ID: Rehmannia28_contig00011394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011394 (383 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamu... 64 3e-11 gb|ABK93131.1| unknown [Populus trichocarpa] 64 3e-11 ref|XP_015942136.1| PREDICTED: 40S ribosomal protein S29 [Arachi... 63 4e-11 ref|XP_015892836.1| PREDICTED: 40S ribosomal protein S29 [Ziziph... 63 4e-11 ref|XP_015892835.1| PREDICTED: 40S ribosomal protein S29 [Ziziph... 63 4e-11 gb|KGN52774.1| hypothetical protein Csa_4G000930 [Cucumis sativus] 63 4e-11 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 63 4e-11 ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prun... 63 4e-11 ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Popu... 63 4e-11 emb|CBI27789.3| unnamed protein product [Vitis vinifera] 63 6e-11 ref|XP_002305134.2| hypothetical protein POPTR_0004s04360g [Popu... 64 6e-11 ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Popu... 64 6e-11 ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Popu... 63 7e-11 ref|XP_015938948.1| PREDICTED: 40S ribosomal protein S29-like [A... 62 8e-11 ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum l... 62 8e-11 gb|ABK93425.1| unknown [Populus trichocarpa] 62 8e-11 ref|XP_006386480.1| hypothetical protein POPTR_0002s12040g [Popu... 64 8e-11 dbj|BAU00845.1| hypothetical protein VIGAN_10248000 [Vigna angul... 63 8e-11 tpg|DAA51657.1| TPA: 40S ribosomal protein S29, partial [Zea mays] 63 9e-11 gb|KOM36224.1| hypothetical protein LR48_Vigan02g237400 [Vigna a... 63 9e-11 >ref|XP_011078121.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747081556|ref|XP_011088056.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747089732|ref|XP_011092516.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] gi|747092208|ref|XP_011093855.1| PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 63.5 bits (153), Expect = 3e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCG 25 >gb|ABK93131.1| unknown [Populus trichocarpa] Length = 56 Score = 63.5 bits (153), Expect = 3e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCG 25 >ref|XP_015942136.1| PREDICTED: 40S ribosomal protein S29 [Arachis duranensis] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_015892836.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] gi|1009171732|ref|XP_015866898.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_015892835.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] gi|1009171734|ref|XP_015866899.1| PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >gb|KGN52774.1| hypothetical protein Csa_4G000930 [Cucumis sativus] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] gi|645261744|ref|XP_008236441.1| PREDICTED: 40S ribosomal protein S29 [Prunus mume] gi|657962892|ref|XP_008373047.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|658061279|ref|XP_008366503.1| PREDICTED: 40S ribosomal protein S29 [Malus domestica] gi|659103501|ref|XP_008452633.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659108782|ref|XP_008454386.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|659110059|ref|XP_008455027.1| PREDICTED: 40S ribosomal protein S29 [Cucumis melo] gi|694414331|ref|XP_009335389.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414333|ref|XP_009335391.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414343|ref|XP_009335395.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|694414345|ref|XP_009335396.1| PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] gi|802570598|ref|XP_012068241.1| PREDICTED: 40S ribosomal protein S29-like [Jatropha curcas] gi|951021513|ref|XP_014512686.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|951050510|ref|XP_014520214.1| PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] gi|1000949638|ref|XP_015579872.1| PREDICTED: 40S ribosomal protein S29 [Ricinus communis] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|700200099|gb|KGN55257.1| 40S ribosomal protein S29 [Cucumis sativus] gi|734330582|gb|KHN06796.1| 40S ribosomal protein S29 [Glycine soja] gi|734423705|gb|KHN42324.1| 40S ribosomal protein S29 [Glycine soja] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_007223556.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] gi|645227016|ref|XP_008220312.1| PREDICTED: 40S ribosomal protein S29-like [Prunus mume] gi|657972348|ref|XP_008377973.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|657972352|ref|XP_008377975.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|658002509|ref|XP_008393747.1| PREDICTED: 40S ribosomal protein S29-like [Malus domestica] gi|694312002|ref|XP_009360488.1| PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] gi|694326383|ref|XP_009354108.1| PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] gi|462420492|gb|EMJ24755.1| hypothetical protein PRUPE_ppa014535mg [Prunus persica] Length = 56 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_002313420.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] gi|550331371|gb|EEE87375.2| hypothetical protein POPTR_0009s09320g [Populus trichocarpa] Length = 57 Score = 63.2 bits (152), Expect = 4e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >emb|CBI27789.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 63.2 bits (152), Expect = 6e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_002305134.2| hypothetical protein POPTR_0004s04360g [Populus trichocarpa] gi|550340304|gb|EEE85645.2| hypothetical protein POPTR_0004s04360g [Populus trichocarpa] Length = 88 Score = 63.5 bits (153), Expect = 6e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCG 25 >ref|XP_002320698.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] gi|550323136|gb|EEE99013.2| hypothetical protein POPTR_0014s01800g [Populus trichocarpa] Length = 90 Score = 63.5 bits (153), Expect = 6e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCG 25 >ref|XP_002298768.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] gi|550348537|gb|EEE83573.2| hypothetical protein POPTR_0001s30310g [Populus trichocarpa] Length = 80 Score = 63.2 bits (152), Expect = 7e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >ref|XP_015938948.1| PREDICTED: 40S ribosomal protein S29-like [Arachis duranensis] Length = 56 Score = 62.4 bits (150), Expect = 8e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGH+NIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHTNIWNSHPKNYGPGSRTCRVCG 25 >ref|NP_001294917.1| uncharacterized protein LOC544138 [Solanum lycopersicum] gi|565361057|ref|XP_006347277.1| PREDICTED: 40S ribosomal protein S29 [Solanum tuberosum] gi|565367342|ref|XP_006350329.1| PREDICTED: 40S ribosomal protein S29 [Solanum tuberosum] gi|697144498|ref|XP_009626362.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|697166313|ref|XP_009591987.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana tomentosiformis] gi|698526017|ref|XP_009759838.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] gi|698575940|ref|XP_009776080.1| PREDICTED: 40S ribosomal protein S29 [Nicotiana sylvestris] gi|970037501|ref|XP_015080098.1| PREDICTED: 40S ribosomal protein S29 [Solanum pennellii] gi|970060309|ref|XP_015056910.1| PREDICTED: 40S ribosomal protein S29 [Solanum pennellii] Length = 56 Score = 62.4 bits (150), Expect = 8e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWN+HPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNAHPKNYGPGSRTCRVCG 25 >gb|ABK93425.1| unknown [Populus trichocarpa] Length = 56 Score = 62.4 bits (150), Expect = 8e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHP+NYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPRNYGPGSRTCRVCG 25 >ref|XP_006386480.1| hypothetical protein POPTR_0002s12040g [Populus trichocarpa] gi|550344828|gb|ERP64277.1| hypothetical protein POPTR_0002s12040g [Populus trichocarpa] Length = 100 Score = 63.5 bits (153), Expect = 8e-11 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSNIWNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCRVCG 25 >dbj|BAU00845.1| hypothetical protein VIGAN_10248000 [Vigna angularis var. angularis] Length = 87 Score = 63.2 bits (152), Expect = 8e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25 >tpg|DAA51657.1| TPA: 40S ribosomal protein S29, partial [Zea mays] Length = 89 Score = 63.2 bits (152), Expect = 9e-11 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +3 Query: 21 IDFELKSYSQIVATMGHSNIWNSHPKNYGPGSRTCRVC 134 + F ++ S A MGHSN+WNSHPKNYGPGSR CRVC Sbjct: 20 LGFTCEACSPAAAAMGHSNVWNSHPKNYGPGSRVCRVC 57 >gb|KOM36224.1| hypothetical protein LR48_Vigan02g237400 [Vigna angularis] Length = 90 Score = 63.2 bits (152), Expect = 9e-11 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 63 MGHSNIWNSHPKNYGPGSRTCRVCG 137 MGHSN+WNSHPKNYGPGSRTCRVCG Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCG 25