BLASTX nr result
ID: Rehmannia28_contig00011343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011343 (303 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097875.1| PREDICTED: ATP synthase gamma chain, chlorop... 54 2e-06 >ref|XP_011097875.1| PREDICTED: ATP synthase gamma chain, chloroplastic-like [Sesamum indicum] Length = 379 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 147 MSCVSLLTGIVPKPSVNFFDSISFKSQLNPFPIFD 251 MSC +LLTG++ KP VN F +ISF+SQLNPFPI D Sbjct: 1 MSCFNLLTGMISKPPVNDFGAISFQSQLNPFPILD 35