BLASTX nr result
ID: Rehmannia28_contig00011296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011296 (1841 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] 56 2e-06 >gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = +1 Query: 1180 SYVPENYRSLIQAMITFVIVLHDKAYKSLLNGFSGQNLVVLDGSLKFWKAADPTPV--TM 1353 +YVP YR LI++M+TFV+ +HD Y + GF N+V+ + +KFWK T + Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTA--GFGMPNIVIKNEVVKFWKVQFITASMGSK 168 Query: 1354 KNDLR*LYHVPTNKLSTGGYTAIPSDMDHLI 1446 ND L+ V + S + +P +M H + Sbjct: 169 NNDFICLHRVVESLFSGEQHLHLPREMQHFL 199 Score = 25.8 bits (55), Expect(2) = 2e-06 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 1551 VISFYSINDGM*LKNHLAVISSAKRLSFFKDAFDKR 1658 +IS D + H+A++S +R+SFF D ++++ Sbjct: 202 LISGTQSEDEYLISRHVAIMSHDERVSFFTDCWERQ 237