BLASTX nr result
ID: Rehmannia28_contig00011168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011168 (770 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 57 1e-07 emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 59 1e-06 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 56.6 bits (135), Expect = 1e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 113 INIRRSITISIKVTDLFSVLSIESILTSHTLIFRKYR 3 + IRR TISIK+TD FSVLSI SI+TSHTLIFRKYR Sbjct: 1 MTIRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = +1 Query: 601 KIESKIKKFQTFYYVSDYYFIWVFLLELYEMKVSYTVLRGGLS 729 K+ KIKKFQTFY +S WVFL ELYEMK SYTVL GG S Sbjct: 6 KLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGGSS 48