BLASTX nr result
ID: Rehmannia28_contig00011138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011138 (645 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086149.1| PREDICTED: G-type lectin S-receptor-like ser... 59 9e-07 ref|XP_011096175.1| PREDICTED: G-type lectin S-receptor-like ser... 58 2e-06 gb|EYU27875.1| hypothetical protein MIMGU_mgv1a001357mg [Erythra... 58 2e-06 ref|XP_012848442.1| PREDICTED: uncharacterized protein LOC105968... 58 2e-06 >ref|XP_011086149.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 [Sesamum indicum] Length = 838 Score = 58.9 bits (141), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 645 DSNIGCMFWSEGLIDIQQFNGVGPELHIRLASSEL 541 + NIGCMFWSE LID+Q+F GVG +LHIRLA+SEL Sbjct: 395 EPNIGCMFWSERLIDVQKFPGVGVDLHIRLAASEL 429 >ref|XP_011096175.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 [Sesamum indicum] Length = 826 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 645 DSNIGCMFWSEGLIDIQQFNGVGPELHIRLASSEL 541 D NIGCMFW E LID+QQF+GVG + +IRLA+SEL Sbjct: 383 DPNIGCMFWGETLIDVQQFSGVGVDFYIRLAASEL 417 >gb|EYU27875.1| hypothetical protein MIMGU_mgv1a001357mg [Erythranthe guttata] Length = 834 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 645 DSNIGCMFWSEGLIDIQQFNGVGPELHIRLASSEL 541 D IGCMFWS LID+QQFNGVG +L+IRL SSEL Sbjct: 394 DLKIGCMFWSGSLIDVQQFNGVGTDLYIRLPSSEL 428 >ref|XP_012848442.1| PREDICTED: uncharacterized protein LOC105968359 [Erythranthe guttata] Length = 1731 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 645 DSNIGCMFWSEGLIDIQQFNGVGPELHIRLASSEL 541 D IGCMFWS LID+QQFNGVG +L+IRL SSEL Sbjct: 1291 DLKIGCMFWSGSLIDVQQFNGVGTDLYIRLPSSEL 1325