BLASTX nr result
ID: Rehmannia28_contig00011122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011122 (921 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090579.1| PREDICTED: pentatricopeptide repeat-containi... 140 1e-33 ref|XP_012845324.1| PREDICTED: pentatricopeptide repeat-containi... 139 3e-33 ref|XP_010025494.1| PREDICTED: pentatricopeptide repeat-containi... 114 6e-25 ref|XP_009608343.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-23 ref|XP_009779325.1| PREDICTED: pentatricopeptide repeat-containi... 109 3e-23 gb|KDO43922.1| hypothetical protein CISIN_1g003937mg [Citrus sin... 106 5e-22 ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containi... 105 9e-22 ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citr... 104 2e-21 emb|CBI21484.3| unnamed protein product [Vitis vinifera] 103 3e-21 ref|XP_002280702.2| PREDICTED: pentatricopeptide repeat-containi... 103 3e-21 ref|XP_010258546.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-21 ref|XP_004237612.1| PREDICTED: pentatricopeptide repeat-containi... 103 6e-21 ref|XP_015072290.1| PREDICTED: pentatricopeptide repeat-containi... 102 8e-21 ref|XP_015941508.1| PREDICTED: pentatricopeptide repeat-containi... 102 8e-21 ref|XP_015936455.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-20 ref|XP_010099917.1| hypothetical protein L484_020104 [Morus nota... 99 2e-19 ref|XP_010555343.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-19 ref|XP_007143255.1| hypothetical protein PHAVU_007G057100g [Phas... 97 7e-19 gb|EPS61204.1| hypothetical protein M569_13595 [Genlisea aurea] 96 2e-18 ref|XP_011468029.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-18 >ref|XP_011090579.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086185|ref|XP_011090580.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086187|ref|XP_011090581.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086189|ref|XP_011090582.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086191|ref|XP_011090583.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086193|ref|XP_011090584.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086195|ref|XP_011090585.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086197|ref|XP_011090588.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086199|ref|XP_011090589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086201|ref|XP_011090590.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] gi|747086203|ref|XP_011090591.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] Length = 783 Score = 140 bits (352), Expect = 1e-33 Identities = 70/89 (78%), Positives = 79/89 (88%) Frame = +2 Query: 653 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 832 MQNPPP SQVDLYASILQTSLKT++ +I+PIHARI+KSGL LGVF+MNN+MNAYAKT Sbjct: 1 MQNPPPPTSQVDLYASILQTSLKTKSLSAIKPIHARIVKSGLHLGVFLMNNLMNAYAKTG 60 Query: 833 FISDARHVFDEMPVRNVSSYNTLLSAYAK 919 F+SDAR VFD M V+NVSSYNTLLSA AK Sbjct: 61 FVSDARRVFDGMSVKNVSSYNTLLSACAK 89 >ref|XP_012845324.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Erythranthe guttata] gi|604319901|gb|EYU31065.1| hypothetical protein MIMGU_mgv1a025575mg [Erythranthe guttata] Length = 783 Score = 139 bits (349), Expect = 3e-33 Identities = 65/89 (73%), Positives = 79/89 (88%) Frame = +2 Query: 653 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 832 M NPPP S+ DLY+SILQT +KT+ PF+++PIHA I+KSGL GVF+MNNVMNAYAK+ Sbjct: 1 MHNPPPCTSKADLYSSILQTGIKTKCPFTVKPIHALILKSGLHFGVFLMNNVMNAYAKSG 60 Query: 833 FISDARHVFDEMPVRNVSSYNTLLSAYAK 919 FISDAR+VFD+MPV+NVS+YNTLLSAYAK Sbjct: 61 FISDARYVFDKMPVKNVSTYNTLLSAYAK 89 >ref|XP_010025494.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Eucalyptus grandis] Length = 786 Score = 114 bits (286), Expect = 6e-25 Identities = 54/89 (60%), Positives = 68/89 (76%) Frame = +2 Query: 653 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 832 + NPPP D YA +LQ SLK ++PF+ R +HA+IIKSGL G+F+MNN+MN YAK+E Sbjct: 4 ISNPPPVPCPSDSYAYLLQASLKNKDPFAARSVHAQIIKSGLHFGLFLMNNLMNFYAKSE 63 Query: 833 FISDARHVFDEMPVRNVSSYNTLLSAYAK 919 F DAR VFDEMP +N SS+NT+LS YAK Sbjct: 64 FRDDARRVFDEMPEKNTSSWNTILSMYAK 92 >ref|XP_009608343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108975|ref|XP_009608344.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108977|ref|XP_009608345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108979|ref|XP_009608346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108981|ref|XP_009608347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108983|ref|XP_009608348.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] gi|697108985|ref|XP_009608349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] Length = 785 Score = 110 bits (274), Expect = 2e-23 Identities = 54/81 (66%), Positives = 65/81 (80%) Frame = +2 Query: 677 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 856 SQ Y S+LQ SLKT+ PF+I+ IH IIKSGL LGVF+MNN++N YAKT F+S AR V Sbjct: 11 SQSHFYVSLLQDSLKTKKPFAIKLIHGSIIKSGLHLGVFLMNNLINGYAKTGFLSYARKV 70 Query: 857 FDEMPVRNVSSYNTLLSAYAK 919 FDEMPVR+ SS+NTLLS Y+K Sbjct: 71 FDEMPVRDTSSWNTLLSGYSK 91 >ref|XP_009779325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] gi|698587963|ref|XP_009779326.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] gi|698587967|ref|XP_009779327.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] gi|698587970|ref|XP_009779328.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] gi|698587974|ref|XP_009779329.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] Length = 785 Score = 109 bits (273), Expect = 3e-23 Identities = 53/81 (65%), Positives = 64/81 (79%) Frame = +2 Query: 677 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 856 SQ Y S+LQ SLKT+ PF+I+ IH I+KSGL GVF+MNNV+N YAKT F+S AR V Sbjct: 11 SQSHFYVSLLQDSLKTKRPFAIKLIHGHIVKSGLHFGVFLMNNVINGYAKTGFLSYARKV 70 Query: 857 FDEMPVRNVSSYNTLLSAYAK 919 FDEMPVR+ SS+NTLLS Y+K Sbjct: 71 FDEMPVRDTSSWNTLLSGYSK 91 >gb|KDO43922.1| hypothetical protein CISIN_1g003937mg [Citrus sinensis] Length = 785 Score = 106 bits (264), Expect = 5e-22 Identities = 52/87 (59%), Positives = 68/87 (78%) Frame = +2 Query: 659 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 838 NPP S ++ YA +LQ++LK+RNPF + +HARIIK GL L VF+ N++MN YAKTE I Sbjct: 5 NPPSLISPLEFYAHLLQSNLKSRNPFVGKLVHARIIKCGLHLSVFLKNSLMNFYAKTESI 64 Query: 839 SDARHVFDEMPVRNVSSYNTLLSAYAK 919 S A+ VFDEMPV+ + S+NT+LSAYAK Sbjct: 65 SYAKKVFDEMPVKTLCSWNTILSAYAK 91 >ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum tuberosum] Length = 786 Score = 105 bits (262), Expect = 9e-22 Identities = 53/88 (60%), Positives = 66/88 (75%) Frame = +2 Query: 656 QNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEF 835 QN SQ Y S+LQ SLK+++PF I+ IH RIIKSG+ L VF+MNN++N YAKT F Sbjct: 4 QNSQSFVSQSHFYVSLLQDSLKSKDPFPIKLIHGRIIKSGIHLSVFLMNNLINGYAKTGF 63 Query: 836 ISDARHVFDEMPVRNVSSYNTLLSAYAK 919 +S AR VFD MPVR+ SS+NTLLS Y+K Sbjct: 64 LSYARKVFDVMPVRDTSSWNTLLSGYSK 91 >ref|XP_006428089.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] gi|568819548|ref|XP_006464311.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Citrus sinensis] gi|985428362|ref|XP_015386583.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Citrus sinensis] gi|557530079|gb|ESR41329.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] Length = 785 Score = 104 bits (260), Expect = 2e-21 Identities = 51/87 (58%), Positives = 67/87 (77%) Frame = +2 Query: 659 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 838 NPP S ++ YA +LQ++LK+RNPF + +H RIIK GL L VF+ N++MN YAKTE I Sbjct: 5 NPPSLISPLEFYAHLLQSNLKSRNPFVGKLVHVRIIKCGLHLSVFLKNSLMNFYAKTESI 64 Query: 839 SDARHVFDEMPVRNVSSYNTLLSAYAK 919 S A+ VFDEMPV+ + S+NT+LSAYAK Sbjct: 65 SYAKKVFDEMPVKTLCSWNTILSAYAK 91 >emb|CBI21484.3| unnamed protein product [Vitis vinifera] Length = 590 Score = 103 bits (258), Expect = 3e-21 Identities = 52/81 (64%), Positives = 63/81 (77%) Frame = +2 Query: 677 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 856 S D Y S LQ SLK ++PF+ + IHARIIK+GL LGVF+MNN+MN YAKT FI DA V Sbjct: 11 SPSDPYTSFLQRSLKFKDPFTGKSIHARIIKAGLHLGVFLMNNLMNFYAKTGFIYDAHRV 70 Query: 857 FDEMPVRNVSSYNTLLSAYAK 919 FDEMPV++V S+N +LS YAK Sbjct: 71 FDEMPVKSVFSWNIILSGYAK 91 >ref|XP_002280702.2| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Vitis vinifera] Length = 785 Score = 103 bits (258), Expect = 3e-21 Identities = 52/81 (64%), Positives = 63/81 (77%) Frame = +2 Query: 677 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 856 S D Y S LQ SLK ++PF+ + IHARIIK+GL LGVF+MNN+MN YAKT FI DA V Sbjct: 11 SPSDPYTSFLQRSLKFKDPFTGKSIHARIIKAGLHLGVFLMNNLMNFYAKTGFIYDAHRV 70 Query: 857 FDEMPVRNVSSYNTLLSAYAK 919 FDEMPV++V S+N +LS YAK Sbjct: 71 FDEMPVKSVFSWNIILSGYAK 91 >ref|XP_010258546.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nelumbo nucifera] Length = 790 Score = 103 bits (258), Expect = 3e-21 Identities = 51/86 (59%), Positives = 65/86 (75%) Frame = +2 Query: 662 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 841 PP S D YA++LQTSLKT P + + IHARIIK+GL LGVF+ NN++N YAK +S Sbjct: 11 PPSFFSPSDFYATLLQTSLKTNIPIAGKSIHARIIKTGLHLGVFLTNNLINFYAKAGSVS 70 Query: 842 DARHVFDEMPVRNVSSYNTLLSAYAK 919 DA +FDEMP++N S+NT+LSAYAK Sbjct: 71 DAHKLFDEMPLKNTFSWNTILSAYAK 96 >ref|XP_004237612.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692198|ref|XP_010319763.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692201|ref|XP_010319764.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692204|ref|XP_010319765.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692207|ref|XP_010319766.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692210|ref|XP_010319767.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692213|ref|XP_010319768.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] gi|723692216|ref|XP_010319769.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum lycopersicum] Length = 786 Score = 103 bits (256), Expect = 6e-21 Identities = 53/88 (60%), Positives = 64/88 (72%) Frame = +2 Query: 656 QNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEF 835 QN SQ Y S LQ SLK++ PF I+ IH RIIKSG+ L VF+MNN++N YAKT F Sbjct: 4 QNSQSFASQSHFYVSFLQDSLKSKVPFPIKLIHGRIIKSGIHLSVFLMNNLINGYAKTGF 63 Query: 836 ISDARHVFDEMPVRNVSSYNTLLSAYAK 919 +S AR VFD MPVR+ SS+NTLLS Y+K Sbjct: 64 LSYARKVFDVMPVRDSSSWNTLLSGYSK 91 >ref|XP_015072290.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum pennellii] gi|970022032|ref|XP_015072291.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum pennellii] gi|970022034|ref|XP_015072292.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum pennellii] gi|970022036|ref|XP_015072293.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Solanum pennellii] Length = 786 Score = 102 bits (255), Expect = 8e-21 Identities = 53/88 (60%), Positives = 64/88 (72%) Frame = +2 Query: 656 QNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEF 835 QN SQ Y S LQ SLK++ PF I+ IH RIIKSG+ L VF+MNN++N YAKT F Sbjct: 4 QNSQSFVSQSHFYVSYLQDSLKSKVPFPIKLIHGRIIKSGIHLSVFLMNNLINGYAKTGF 63 Query: 836 ISDARHVFDEMPVRNVSSYNTLLSAYAK 919 +S AR VFD MPVR+ SS+NTLLS Y+K Sbjct: 64 LSYARKVFDVMPVRDTSSWNTLLSGYSK 91 >ref|XP_015941508.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] Length = 797 Score = 102 bits (255), Expect = 8e-21 Identities = 51/90 (56%), Positives = 66/90 (73%), Gaps = 3/90 (3%) Frame = +2 Query: 659 NPPPRRSQV---DLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKT 829 NPP S DLYA +LQ+++K+R+PF R +HARIIK GL LGVF+MNN++N YAKT Sbjct: 5 NPPCTTSYASHSDLYADVLQSAIKSRDPFVGRSVHARIIKHGLHLGVFLMNNLLNFYAKT 64 Query: 830 EFISDARHVFDEMPVRNVSSYNTLLSAYAK 919 SD VF EMP++ + S+NT+LSAYAK Sbjct: 65 GSFSDVHRVFAEMPLKTIFSWNTILSAYAK 94 >ref|XP_015936455.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] gi|1012223799|ref|XP_015936456.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] gi|1012223803|ref|XP_015936457.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] gi|1012223807|ref|XP_015936458.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] gi|1012223811|ref|XP_015936460.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] gi|1012223815|ref|XP_015936461.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis duranensis] Length = 788 Score = 100 bits (250), Expect = 3e-20 Identities = 48/81 (59%), Positives = 63/81 (77%) Frame = +2 Query: 677 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 856 S DLYA +LQ+++K+R+PF R +HARIIK GL LGVF+MNN++N YAKT SD V Sbjct: 14 SHSDLYADVLQSAIKSRDPFVGRSVHARIIKHGLHLGVFLMNNLLNFYAKTGSFSDVHCV 73 Query: 857 FDEMPVRNVSSYNTLLSAYAK 919 F EMP++ + S+NT+LSAYAK Sbjct: 74 FAEMPLKTIFSWNTILSAYAK 94 >ref|XP_010099917.1| hypothetical protein L484_020104 [Morus notabilis] gi|587892259|gb|EXB80846.1| hypothetical protein L484_020104 [Morus notabilis] Length = 799 Score = 98.6 bits (244), Expect = 2e-19 Identities = 48/87 (55%), Positives = 63/87 (72%) Frame = +2 Query: 659 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 838 NP + YA LQT LK R+PF+ + IHA+IIKSG+ + VF+MNN+MN YAK+ + Sbjct: 5 NPSFNAFSSEFYAYHLQTRLKLRDPFAGKSIHAQIIKSGIYMSVFLMNNLMNFYAKSRSV 64 Query: 839 SDARHVFDEMPVRNVSSYNTLLSAYAK 919 SDA +FDEMPVR S+NT+L+AYAK Sbjct: 65 SDAHRLFDEMPVRTTFSWNTILTAYAK 91 >ref|XP_010555343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Tarenaya hassleriana] Length = 785 Score = 97.4 bits (241), Expect = 5e-19 Identities = 47/86 (54%), Positives = 62/86 (72%) Frame = +2 Query: 662 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 841 PP + DLY +LQ SLK+ + F+ + +H RIIKSGL VF+MNN+MN Y+KT + Sbjct: 5 PPSLAPRSDLYIHLLQKSLKSNDLFTAQSVHGRIIKSGLVFSVFLMNNLMNFYSKTGYAI 64 Query: 842 DARHVFDEMPVRNVSSYNTLLSAYAK 919 DAR +FDEMP+R S+NT+LSAYAK Sbjct: 65 DARKLFDEMPLRTAFSWNTVLSAYAK 90 >ref|XP_007143255.1| hypothetical protein PHAVU_007G057100g [Phaseolus vulgaris] gi|561016445|gb|ESW15249.1| hypothetical protein PHAVU_007G057100g [Phaseolus vulgaris] Length = 786 Score = 97.1 bits (240), Expect = 7e-19 Identities = 50/91 (54%), Positives = 67/91 (73%) Frame = +2 Query: 647 IIMQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAK 826 ++MQNP P S D + +LQ+++K+R+PF R IHA IIK GL LGVF+MNN++N YAK Sbjct: 3 VLMQNPNPP-SPSDKWPFLLQSAIKSRDPFLGRCIHAPIIKHGLCLGVFLMNNLLNFYAK 61 Query: 827 TEFISDARHVFDEMPVRNVSSYNTLLSAYAK 919 T SDA VFDEMP++ S+NT+LS +AK Sbjct: 62 TGSFSDAHRVFDEMPLKTTFSWNTILSMHAK 92 >gb|EPS61204.1| hypothetical protein M569_13595 [Genlisea aurea] Length = 811 Score = 95.9 bits (237), Expect = 2e-18 Identities = 45/69 (65%), Positives = 57/69 (82%) Frame = +2 Query: 713 SLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHVFDEMPVRNVSSY 892 S+K +NPF IRP H +IKSGLQ VF+MNN++NAYAK+ I DAR +FD MPV+++SSY Sbjct: 47 SIKAKNPFVIRPAHTFVIKSGLQGVVFLMNNLVNAYAKSGSICDARELFDHMPVKDISSY 106 Query: 893 NTLLSAYAK 919 NT+LSAYAK Sbjct: 107 NTILSAYAK 115 >ref|XP_011468029.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Fragaria vesca subsp. vesca] Length = 781 Score = 95.5 bits (236), Expect = 2e-18 Identities = 47/78 (60%), Positives = 58/78 (74%) Frame = +2 Query: 686 DLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHVFDE 865 D YA +LQ L R+PF+ + IHA+IIKSGL LGVF+MNN++N Y KT DA HVFDE Sbjct: 10 DSYALLLQACLNKRHPFAGKTIHAQIIKSGLHLGVFLMNNLINYYIKTGSYVDAHHVFDE 69 Query: 866 MPVRNVSSYNTLLSAYAK 919 MP+RN S+NT+LS Y K Sbjct: 70 MPLRNRFSWNTILSNYTK 87