BLASTX nr result
ID: Rehmannia28_contig00011119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00011119 (356 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containi... 68 6e-11 gb|EYU42850.1| hypothetical protein MIMGU_mgv1a0029291mg, partia... 57 4e-07 gb|KYP69223.1| Pentatricopeptide repeat-containing protein At3g5... 53 7e-06 gb|KHN37371.1| Pentatricopeptide repeat-containing protein [Glyc... 53 1e-05 >ref|XP_012830908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g59040 [Erythranthe guttata] Length = 630 Score = 67.8 bits (164), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 356 SGVPPDQKSKNILLSLAKTVEEQIEAKQLVENQSINRLLNNVE 228 SGV PDQK+KNILLSLAKT EEQ EAKQ+VE+ S++R+LNNVE Sbjct: 485 SGVSPDQKAKNILLSLAKTAEEQTEAKQIVESLSLDRILNNVE 527 >gb|EYU42850.1| hypothetical protein MIMGU_mgv1a0029291mg, partial [Erythranthe guttata] Length = 424 Score = 56.6 bits (135), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 356 SGVPPDQKSKNILLSLAKTVEEQIEAKQLVENQSI 252 SGV PDQK+KNILLSLAKT EEQ EAKQ+VEN + Sbjct: 291 SGVSPDQKAKNILLSLAKTAEEQTEAKQIVENDDV 325 >gb|KYP69223.1| Pentatricopeptide repeat-containing protein At3g59040 family [Cajanus cajan] Length = 556 Score = 53.1 bits (126), Expect = 7e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 356 SGVPPDQKSKNILLSLAKTVEEQIEAKQLVENQSINRLLNNVEG 225 SGVPPDQK+KN+LLSLA T EE+ EA +LV + S N L+N+ G Sbjct: 481 SGVPPDQKAKNVLLSLATTDEERKEANELVVHFSENNSLHNLNG 524 >gb|KHN37371.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 523 Score = 52.8 bits (125), Expect = 1e-05 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 356 SGVPPDQKSKNILLSLAKTVEEQIEAKQLVENQSINRLLNNVEG 225 +G+PPDQK+KN+LLSLAKT EE+ EA +LV + S N L+ V G Sbjct: 449 NGIPPDQKAKNVLLSLAKTDEEREEANELVGHFSENNSLSKVNG 492