BLASTX nr result
ID: Rehmannia28_contig00010562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00010562 (399 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073297.1| PREDICTED: DET1- and DDB1-associated protein... 79 8e-17 ref|XP_010658376.1| PREDICTED: DET1- and DDB1-associated protein... 62 5e-10 ref|XP_002278358.1| PREDICTED: DET1- and DDB1-associated protein... 62 5e-10 ref|XP_014494870.1| PREDICTED: DET1- and DDB1-associated protein... 61 9e-10 gb|KOM40561.1| hypothetical protein LR48_Vigan04g075900 [Vigna a... 61 9e-10 ref|XP_008437336.1| PREDICTED: uncharacterized protein LOC103482... 60 1e-09 ref|XP_004143885.1| PREDICTED: DET1- and DDB1-associated protein... 60 1e-09 gb|EEF51248.1| conserved hypothetical protein [Ricinus communis] 59 2e-09 gb|KNA22598.1| hypothetical protein SOVF_030900 [Spinacia oleracea] 60 2e-09 gb|KHN14963.1| hypothetical protein glysoja_024083 [Glycine soja] 59 4e-09 ref|XP_002509861.2| PREDICTED: DET1- and DDB1-associated protein... 59 4e-09 ref|XP_012470544.1| PREDICTED: uncharacterized protein LOC105788... 59 4e-09 ref|XP_007162170.1| hypothetical protein PHAVU_001G130100g [Phas... 59 5e-09 ref|XP_003554167.1| PREDICTED: uncharacterized protein LOC100784... 59 7e-09 ref|XP_010673716.1| PREDICTED: DET1- and DDB1-associated protein... 58 1e-08 gb|KVH95412.1| Ubiquitin ligase, Det1/DDB1-complexing [Cynara ca... 56 5e-08 ref|XP_002465956.1| hypothetical protein SORBIDRAFT_01g048810 [S... 57 9e-08 ref|XP_009389322.1| PREDICTED: DET1- and DDB1-associated protein... 56 9e-08 ref|XP_008238955.1| PREDICTED: uncharacterized protein LOC103337... 55 2e-07 ref|XP_004985896.1| PREDICTED: uncharacterized protein LOC101768... 55 2e-07 >ref|XP_011073297.1| PREDICTED: DET1- and DDB1-associated protein 1 [Sesamum indicum] Length = 95 Score = 79.0 bits (193), Expect = 8e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 4 PEAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYDNN 141 PEAKNILLRHFYQ AEEKLR+KRA DNPSPERASK+PR SA DN+ Sbjct: 49 PEAKNILLRHFYQPAEEKLRSKRAPCDNPSPERASKLPRPSASDNS 94 >ref|XP_010658376.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X2 [Vitis vinifera] Length = 94 Score = 61.6 bits (148), Expect = 5e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYD 135 E KNILLRHFYQ AEEKLR KRA+S++ +PE K PRASA D Sbjct: 52 ETKNILLRHFYQRAEEKLRPKRAASEHLTPEHGCKQPRASASD 94 >ref|XP_002278358.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X1 [Vitis vinifera] gi|297742241|emb|CBI34390.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 61.6 bits (148), Expect = 5e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYD 135 E KNILLRHFYQ AEEKLR KRA+S++ +PE K PRASA D Sbjct: 53 ETKNILLRHFYQRAEEKLRPKRAASEHLTPEHGCKQPRASASD 95 >ref|XP_014494870.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] gi|950948131|ref|XP_014494871.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] gi|950948135|ref|XP_014494872.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] gi|950948138|ref|XP_014494873.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] gi|950948142|ref|XP_014494874.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] gi|950948146|ref|XP_014494875.1| PREDICTED: DET1- and DDB1-associated protein 1 [Vigna radiata var. radiata] Length = 93 Score = 60.8 bits (146), Expect = 9e-10 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 EAKNILLRH YQHAEEKL+ KRA+SDN PE K PR S+ Sbjct: 53 EAKNILLRHIYQHAEEKLKPKRAASDNLLPEHGCKQPRVSS 93 >gb|KOM40561.1| hypothetical protein LR48_Vigan04g075900 [Vigna angularis] gi|965670627|dbj|BAT85234.1| hypothetical protein VIGAN_04275800 [Vigna angularis var. angularis] Length = 93 Score = 60.8 bits (146), Expect = 9e-10 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 EAKNILLRH YQHAEEKL+ KRA+SDN PE K PR S+ Sbjct: 53 EAKNILLRHIYQHAEEKLKPKRAASDNLLPEHGCKQPRVSS 93 >ref|XP_008437336.1| PREDICTED: uncharacterized protein LOC103482787 isoform X2 [Cucumis melo] gi|778699489|ref|XP_011654719.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X2 [Cucumis sativus] Length = 97 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNIL+RH YQH EEK RTKR ++++P PE SK PRAS Sbjct: 52 EAKNILIRHIYQHTEEKSRTKRPAAEHPMPEHGSKQPRAS 91 >ref|XP_004143885.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X1 [Cucumis sativus] gi|659073941|ref|XP_008437335.1| PREDICTED: uncharacterized protein LOC103482787 isoform X1 [Cucumis melo] gi|700194881|gb|KGN50058.1| hypothetical protein Csa_5G152230 [Cucumis sativus] Length = 98 Score = 60.5 bits (145), Expect = 1e-09 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNIL+RH YQH EEK RTKR ++++P PE SK PRAS Sbjct: 53 EAKNILIRHIYQHTEEKSRTKRPAAEHPMPEHGSKQPRAS 92 >gb|EEF51248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 59.3 bits (142), Expect = 2e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNILLR+FY+ AEEKLRTKRA+S+N PE K PRAS Sbjct: 24 EAKNILLRNFYERAEEKLRTKRAASENLIPEHGCKQPRAS 63 >gb|KNA22598.1| hypothetical protein SOVF_030900 [Spinacia oleracea] Length = 99 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 E+KNIL+RHFY+HA+EKLR KRA+S+N +PE +K PR+S+ Sbjct: 53 ESKNILIRHFYKHADEKLRPKRAASENLAPENGAKHPRSSS 93 >gb|KHN14963.1| hypothetical protein glysoja_024083 [Glycine soja] Length = 64 Score = 58.5 bits (140), Expect = 4e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 EAKNIL+RH YQHAEEKL+ KRA+SDN P+ K PR S+ Sbjct: 24 EAKNILVRHIYQHAEEKLKPKRAASDNLLPDHGCKQPRVSS 64 >ref|XP_002509861.2| PREDICTED: DET1- and DDB1-associated protein 1 [Ricinus communis] Length = 95 Score = 59.3 bits (142), Expect = 4e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNILLR+FY+ AEEKLRTKRA+S+N PE K PRAS Sbjct: 53 EAKNILLRNFYERAEEKLRTKRAASENLIPEHGCKQPRAS 92 >ref|XP_012470544.1| PREDICTED: uncharacterized protein LOC105788280 isoform X1 [Gossypium raimondii] gi|763751738|gb|KJB19126.1| hypothetical protein B456_003G085700 [Gossypium raimondii] Length = 97 Score = 59.3 bits (142), Expect = 4e-09 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNIL+R+FYQ AEEKLR KRA++++P+PE K PRAS Sbjct: 54 EAKNILIRNFYQRAEEKLRPKRAATEHPTPEHGCKQPRAS 93 >ref|XP_007162170.1| hypothetical protein PHAVU_001G130100g [Phaseolus vulgaris] gi|561035634|gb|ESW34164.1| hypothetical protein PHAVU_001G130100g [Phaseolus vulgaris] Length = 93 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 EAKNILLRH YQHAEEKL+ KRA+ DN PE K PR S+ Sbjct: 53 EAKNILLRHIYQHAEEKLKPKRAAPDNLLPEHGCKQPRVSS 93 >ref|XP_003554167.1| PREDICTED: uncharacterized protein LOC100784555 [Glycine max] gi|571557044|ref|XP_006604351.1| PREDICTED: uncharacterized protein LOC100784555 [Glycine max] gi|947045601|gb|KRG95230.1| hypothetical protein GLYMA_19G137300 [Glycine max] gi|947045602|gb|KRG95231.1| hypothetical protein GLYMA_19G137300 [Glycine max] Length = 93 Score = 58.5 bits (140), Expect = 7e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 EAKNIL+RH YQHAEEKL+ KRA+SDN P+ K PR S+ Sbjct: 53 EAKNILVRHIYQHAEEKLKPKRAASDNLLPDHGCKQPRVSS 93 >ref|XP_010673716.1| PREDICTED: DET1- and DDB1-associated protein 1 [Beta vulgaris subsp. vulgaris] gi|870863406|gb|KMT14570.1| hypothetical protein BVRB_4g073400 [Beta vulgaris subsp. vulgaris] Length = 98 Score = 58.2 bits (139), Expect = 1e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASA 129 E+KNIL+RHFY+HAE+KLR KRA+S++ +PE K PRAS+ Sbjct: 53 ESKNILIRHFYKHAEDKLRPKRAASEHLAPENGVKHPRASS 93 >gb|KVH95412.1| Ubiquitin ligase, Det1/DDB1-complexing [Cynara cardunculus var. scolymus] Length = 76 Score = 55.8 bits (133), Expect = 5e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRAS 126 EAKNILLR YQ ++EKLR KRA+S+N +PE+ SK PRAS Sbjct: 28 EAKNILLRQLYQRSDEKLRPKRAASENLAPEQESKHPRAS 67 >ref|XP_002465956.1| hypothetical protein SORBIDRAFT_01g048810 [Sorghum bicolor] gi|241919810|gb|EER92954.1| hypothetical protein SORBI_001G524100 [Sorghum bicolor] Length = 128 Score = 56.6 bits (135), Expect = 9e-08 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYD 135 EA+NILLRHFYQ +EEKLR KRA+ DN +PE +K PR D Sbjct: 77 EARNILLRHFYQKSEEKLRPKRAAPDNLAPENNNKQPRGPVGD 119 >ref|XP_009389322.1| PREDICTED: DET1- and DDB1-associated protein 1-like [Musa acuminata subsp. malaccensis] gi|695005722|ref|XP_009389323.1| PREDICTED: DET1- and DDB1-associated protein 1-like [Musa acuminata subsp. malaccensis] Length = 99 Score = 55.8 bits (133), Expect = 9e-08 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYD 135 EA+NILLRHFYQ +EEK R KRA+SD+ +PE + K PR + D Sbjct: 54 EARNILLRHFYQKSEEKFRPKRAASDHLTPEHSCKQPRCAYTD 96 >ref|XP_008238955.1| PREDICTED: uncharacterized protein LOC103337570 [Prunus mume] Length = 100 Score = 55.1 bits (131), Expect = 2e-07 Identities = 28/44 (63%), Positives = 32/44 (72%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYDN 138 E KNILLRH YQ+ EEKLR KRA+S++ PE SK RAS DN Sbjct: 53 ETKNILLRHMYQNDEEKLRQKRAASEHLLPEHGSKQLRASVSDN 96 >ref|XP_004985896.1| PREDICTED: uncharacterized protein LOC101768393 [Setaria italica] Length = 104 Score = 55.1 bits (131), Expect = 2e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = +1 Query: 7 EAKNILLRHFYQHAEEKLRTKRASSDNPSPERASKVPRASAYD 135 E +NILLRHFYQ +EEKLR KRA+ DN +PE +K PR D Sbjct: 53 EPRNILLRHFYQKSEEKLRPKRAAPDNLAPENNNKQPRGPVAD 95