BLASTX nr result
ID: Rehmannia28_contig00010313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00010313 (491 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013467567.1| DUF223 domain protein [Medicago truncatula] ... 48 4e-06 >ref|XP_013467567.1| DUF223 domain protein [Medicago truncatula] gi|657402731|gb|KEH41604.1| DUF223 domain protein [Medicago truncatula] Length = 334 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 73 NRVTCTLWEDYVDTILPYLEEHSRE-PFVIIIQMCRAKVYRG 195 NR+ CTLW+DY + + +LE H P VI+IQMC+ K Y G Sbjct: 133 NRIHCTLWDDYAEQLKRFLESHDPNLPAVILIQMCKLKKYFG 174 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 269 QHLGEVKVSNTYHVTKLIVDVEEEAIKEYKRRYN 370 ++ G + +SN ++ TKL+ DVE + Y R N Sbjct: 171 KYFGAMGISNAFYGTKLLFDVELPEVASYLERMN 204