BLASTX nr result
ID: Rehmannia28_contig00010000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00010000 (1520 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 65 4e-10 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 65.5 bits (158), Expect = 4e-10 Identities = 35/69 (50%), Positives = 40/69 (57%) Frame = +3 Query: 105 FLSYPGGGNGKQRDIAHFPRTNKVTTIKRKIFLYYCP*TAVFQYENRPALIFLSIQHDPT 284 F SYPGGGNGKQRDIA K ++ L Y P A+FQ N P + LS+ H PT Sbjct: 4 FFSYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFP-VALFQERNEPVTMLLSMHHVPT 62 Query: 285 LISSFNILP 311 ISSFN P Sbjct: 63 FISSFNNPP 71