BLASTX nr result
ID: Rehmannia28_contig00009924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009924 (558 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [... 61 7e-08 >ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum] Length = 517 Score = 61.2 bits (147), Expect = 7e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 558 EDLVDVFLRIQKSGELEFPIGNDNIKAVIY 469 EDLVDVFLRIQ+SGELEFPIGNDNIKAVIY Sbjct: 284 EDLVDVFLRIQESGELEFPIGNDNIKAVIY 313