BLASTX nr result
ID: Rehmannia28_contig00009846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009846 (337 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] 66 2e-10 ref|XP_009797245.1| PREDICTED: cystathionine gamma-synthase, chl... 66 2e-10 ref|XP_009592901.1| PREDICTED: cystathionine gamma-synthase, chl... 66 2e-10 gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] 66 2e-10 gb|KDO72637.1| hypothetical protein CISIN_1g0091671mg, partial [... 61 2e-10 dbj|BAR72290.1| Cystathionine gamma synthase [Nicotiana benthami... 65 5e-10 ref|NP_001305603.1| cystathionine gamma-synthase 1, chloroplasti... 64 7e-10 ref|XP_015065851.1| PREDICTED: cystathionine gamma-synthase 1, c... 64 7e-10 ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycope... 64 7e-10 ref|NP_001274915.1| cystathionine-gamma-synthase [Solanum tubero... 64 7e-10 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 64 1e-09 ref|XP_009775846.1| PREDICTED: cystathionine gamma-synthase, chl... 64 1e-09 gb|AJF83863.1| cystathionine gamma synthase 1 [Nicotiana tabacum] 64 1e-09 ref|XP_009775845.1| PREDICTED: cystathionine gamma-synthase, chl... 64 1e-09 gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] 64 1e-09 ref|XP_009602125.1| PREDICTED: cystathionine gamma-synthase, chl... 64 1e-09 ref|XP_009602123.1| PREDICTED: cystathionine gamma-synthase, chl... 64 1e-09 gb|KDO72635.1| hypothetical protein CISIN_1g0091671mg, partial [... 61 1e-09 gb|KDO72629.1| hypothetical protein CISIN_1g0091673mg, partial [... 61 1e-09 ref|XP_009628949.1| PREDICTED: cystathionine gamma-synthase, chl... 64 1e-09 >gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 527 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFEDLK+DILQ Sbjct: 490 SQSDRAKYGILDNLVRFSFGVEDFEDLKADILQ 522 >ref|XP_009797245.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana sylvestris] Length = 552 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFEDLK+DILQ Sbjct: 515 SQSDRAKYGILDNLVRFSFGVEDFEDLKADILQ 547 >ref|XP_009592901.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana tomentosiformis] Length = 553 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFEDLK+DILQ Sbjct: 516 SQSDRAKYGILDNLVRFSFGVEDFEDLKADILQ 548 >gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] Length = 553 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFEDLK+DILQ Sbjct: 516 SQSDRAKYGILDNLVRFSFGVEDFEDLKADILQ 548 >gb|KDO72637.1| hypothetical protein CISIN_1g0091671mg, partial [Citrus sinensis] Length = 80 Score = 61.2 bits (147), Expect = 2e-10 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQS+R KYGI+DNLVR+SFGVEDFEDLK+D+LQ Sbjct: 43 SQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQ 75 >dbj|BAR72290.1| Cystathionine gamma synthase [Nicotiana benthamiana] Length = 552 Score = 64.7 bits (156), Expect = 5e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDF+DLK+DILQ Sbjct: 515 SQSDRAKYGILDNLVRFSFGVEDFDDLKADILQ 547 >ref|NP_001305603.1| cystathionine gamma-synthase 1, chloroplastic-like [Solanum tuberosum] gi|8439541|gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum] Length = 539 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFED+K+D+LQ Sbjct: 502 SQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQ 534 >ref|XP_015065851.1| PREDICTED: cystathionine gamma-synthase 1, chloroplastic [Solanum pennellii] Length = 540 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFED+K+D+LQ Sbjct: 503 SQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQ 535 >ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum] gi|40806079|gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum] Length = 540 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFED+K+D+LQ Sbjct: 503 SQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQ 535 >ref|NP_001274915.1| cystathionine-gamma-synthase [Solanum tuberosum] gi|5834422|gb|AAD31520.2|AF144102_1 cystathionine-gamma-synthase [Solanum tuberosum] Length = 583 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGILDNLVR+SFGVEDFED+K+D+LQ Sbjct: 503 SQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQ 535 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 408 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 440 >ref|XP_009775846.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform X2 [Nicotiana sylvestris] Length = 502 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 465 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 497 >gb|AJF83863.1| cystathionine gamma synthase 1 [Nicotiana tabacum] Length = 537 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 500 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 532 >ref|XP_009775845.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform X1 [Nicotiana sylvestris] Length = 538 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 501 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 533 >gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 540 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 503 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 535 >ref|XP_009602125.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform X2 [Nicotiana tomentosiformis] Length = 565 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 528 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 560 >ref|XP_009602123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform X1 [Nicotiana tomentosiformis] Length = 601 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDF+DLK+DILQ Sbjct: 564 SQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQ 596 >gb|KDO72635.1| hypothetical protein CISIN_1g0091671mg, partial [Citrus sinensis] Length = 148 Score = 61.2 bits (147), Expect = 1e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQS+R KYGI+DNLVR+SFGVEDFEDLK+D+LQ Sbjct: 111 SQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQ 143 >gb|KDO72629.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis] gi|641853812|gb|KDO72630.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis] gi|641853813|gb|KDO72631.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis] Length = 148 Score = 61.2 bits (147), Expect = 1e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQS+R KYGI+DNLVR+SFGVEDFEDLK+D+LQ Sbjct: 111 SQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQ 143 >ref|XP_009628949.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana tomentosiformis] Length = 527 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 336 SQSDRAKYGILDNLVRYSFGVEDFEDLKSDILQ 238 SQSDRAKYGI+DNLVR+SFGVEDFED+K+D+LQ Sbjct: 490 SQSDRAKYGIMDNLVRFSFGVEDFEDVKADVLQ 522