BLASTX nr result
ID: Rehmannia28_contig00009401
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009401 (377 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095444.1| PREDICTED: small ubiquitin-related modifier ... 162 7e-50 ref|XP_011095443.1| PREDICTED: small ubiquitin-related modifier ... 162 7e-50 ref|XP_009411857.1| PREDICTED: small ubiquitin-related modifier ... 156 2e-47 ref|XP_008342135.1| PREDICTED: small ubiquitin-related modifier ... 153 2e-46 ref|XP_008230020.1| PREDICTED: small ubiquitin-related modifier ... 153 2e-46 ref|XP_008379672.1| PREDICTED: small ubiquitin-related modifier ... 153 2e-46 ref|XP_010926757.1| PREDICTED: small ubiquitin-related modifier ... 153 3e-46 ref|XP_009412743.1| PREDICTED: small ubiquitin-related modifier ... 153 4e-46 ref|XP_007217180.1| hypothetical protein PRUPE_ppa012976mg [Prun... 154 5e-46 ref|XP_010929803.1| PREDICTED: small ubiquitin-related modifier ... 152 1e-45 ref|XP_010927676.1| PREDICTED: small ubiquitin-related modifier ... 151 2e-45 ref|XP_002274949.1| PREDICTED: small ubiquitin-related modifier ... 151 2e-45 ref|XP_008794940.1| PREDICTED: small ubiquitin-related modifier ... 151 2e-45 ref|XP_008794618.1| PREDICTED: small ubiquitin-related modifier ... 150 4e-45 ref|XP_010241409.1| PREDICTED: small ubiquitin-related modifier ... 150 6e-45 ref|XP_011095446.1| PREDICTED: small ubiquitin-related modifier ... 149 7e-45 ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutr... 149 9e-45 ref|XP_008775626.1| PREDICTED: small ubiquitin-related modifier ... 149 1e-44 ref|XP_008385845.1| PREDICTED: small ubiquitin-related modifier ... 149 2e-44 ref|XP_007212287.1| hypothetical protein PRUPE_ppa013880mg [Prun... 149 2e-44 >ref|XP_011095444.1| PREDICTED: small ubiquitin-related modifier 1 isoform X2 [Sesamum indicum] gi|747095165|ref|XP_011095445.1| PREDICTED: small ubiquitin-related modifier 1 isoform X3 [Sesamum indicum] Length = 97 Score = 162 bits (410), Expect = 7e-50 Identities = 78/81 (96%), Positives = 79/81 (97%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MSTP Q+EDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA Sbjct: 1 MSTPSQEEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEMED Sbjct: 61 FLFDGRRLRGEQTPDELEMED 81 >ref|XP_011095443.1| PREDICTED: small ubiquitin-related modifier 1 isoform X1 [Sesamum indicum] Length = 97 Score = 162 bits (410), Expect = 7e-50 Identities = 78/81 (96%), Positives = 79/81 (97%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MSTP Q+EDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA Sbjct: 1 MSTPSQEEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEMED Sbjct: 61 FLFDGRRLRGEQTPDELEMED 81 >ref|XP_009411857.1| PREDICTED: small ubiquitin-related modifier 2-like [Musa acuminata subsp. malaccensis] Length = 99 Score = 156 bits (394), Expect = 2e-47 Identities = 75/81 (92%), Positives = 77/81 (95%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS PGQ+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFN+IA Sbjct: 1 MSGPGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNAIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEMED Sbjct: 61 FLFDGRRLRGEQTPDELEMED 81 >ref|XP_008342135.1| PREDICTED: small ubiquitin-related modifier 1-like [Malus domestica] Length = 98 Score = 153 bits (387), Expect = 2e-46 Identities = 74/81 (91%), Positives = 77/81 (95%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MSTP Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 1 MSTPQQEEDKKPNDQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEMNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLRAEQTPDELEMED Sbjct: 61 FLFDGRRLRAEQTPDELEMED 81 >ref|XP_008230020.1| PREDICTED: small ubiquitin-related modifier 1-like [Prunus mume] gi|645247832|ref|XP_008230021.1| PREDICTED: small ubiquitin-related modifier 1-like [Prunus mume] Length = 98 Score = 153 bits (387), Expect = 2e-46 Identities = 74/81 (91%), Positives = 77/81 (95%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MSTP Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 1 MSTPQQEEDKKPNDQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLRAEQTPDELEMED Sbjct: 61 FLFDGRRLRAEQTPDELEMED 81 >ref|XP_008379672.1| PREDICTED: small ubiquitin-related modifier 1-like [Malus domestica] gi|658044366|ref|XP_008357832.1| PREDICTED: small ubiquitin-related modifier 1-like [Malus domestica] gi|694377642|ref|XP_009365110.1| PREDICTED: small ubiquitin-related modifier 1-like [Pyrus x bretschneideri] Length = 99 Score = 153 bits (387), Expect = 2e-46 Identities = 74/81 (91%), Positives = 77/81 (95%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MSTP Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSIA Sbjct: 1 MSTPQQEEDKKPNDQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEMNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLRAEQTPDELEMED Sbjct: 61 FLFDGRRLRAEQTPDELEMED 81 >ref|XP_010926757.1| PREDICTED: small ubiquitin-related modifier 2 [Elaeis guineensis] Length = 96 Score = 153 bits (386), Expect = 3e-46 Identities = 74/81 (91%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS GQ+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEMED Sbjct: 61 FLFDGRRLRGEQTPDELEMED 81 >ref|XP_009412743.1| PREDICTED: small ubiquitin-related modifier 1-like [Musa acuminata subsp. malaccensis] Length = 108 Score = 153 bits (386), Expect = 4e-46 Identities = 74/81 (91%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS GQ+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEMED Sbjct: 61 FLFDGRRLRGEQTPDELEMED 81 >ref|XP_007217180.1| hypothetical protein PRUPE_ppa012976mg [Prunus persica] gi|462413330|gb|EMJ18379.1| hypothetical protein PRUPE_ppa012976mg [Prunus persica] Length = 147 Score = 154 bits (389), Expect = 5e-46 Identities = 74/82 (90%), Positives = 78/82 (95%) Frame = +1 Query: 130 RMSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSI 309 +MSTP Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+ NSI Sbjct: 49 KMSTPQQEEDKKPNDQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSI 108 Query: 310 AFLFDGRRLRAEQTPDELEMED 375 AFLFDGRRLRAEQTPDELEMED Sbjct: 109 AFLFDGRRLRAEQTPDELEMED 130 >ref|XP_010929803.1| PREDICTED: small ubiquitin-related modifier 2-like [Elaeis guineensis] Length = 102 Score = 152 bits (383), Expect = 1e-45 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSAAAQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLRAEQTPDELEMED Sbjct: 61 FLFDGRRLRAEQTPDELEMED 81 >ref|XP_010927676.1| PREDICTED: small ubiquitin-related modifier 1-like [Elaeis guineensis] Length = 103 Score = 151 bits (382), Expect = 2e-45 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS GQ+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTP+ELEMED Sbjct: 61 FLFDGRRLRGEQTPEELEMED 81 >ref|XP_002274949.1| PREDICTED: small ubiquitin-related modifier 1 [Vitis vinifera] gi|297739210|emb|CBI28861.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 151 bits (381), Expect = 2e-45 Identities = 73/76 (96%), Positives = 73/76 (96%) Frame = +1 Query: 148 QDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDG 327 QDEDKKP DQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVD NSIAFLFDG Sbjct: 10 QDEDKKPNDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSIAFLFDG 69 Query: 328 RRLRAEQTPDELEMED 375 RRLR EQTPDELEMED Sbjct: 70 RRLRGEQTPDELEMED 85 >ref|XP_008794940.1| PREDICTED: small ubiquitin-related modifier 2-like [Phoenix dactylifera] Length = 102 Score = 151 bits (381), Expect = 2e-45 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS Q+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAAQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLRAEQTPDELEMED Sbjct: 61 FLFDGRRLRAEQTPDELEMED 81 >ref|XP_008794618.1| PREDICTED: small ubiquitin-related modifier 1-like [Phoenix dactylifera] Length = 103 Score = 150 bits (379), Expect = 4e-45 Identities = 72/81 (88%), Positives = 76/81 (93%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS GQ+EDKKP DQ+ HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTP+ELEMED Sbjct: 61 FLFDGRRLRGEQTPEELEMED 81 >ref|XP_010241409.1| PREDICTED: small ubiquitin-related modifier 1-like [Nelumbo nucifera] Length = 100 Score = 150 bits (378), Expect = 6e-45 Identities = 72/80 (90%), Positives = 74/80 (92%) Frame = +1 Query: 136 STPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAF 315 + P QDEDKKP DQS HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVD NSIAF Sbjct: 3 AAPSQDEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDLNSIAF 62 Query: 316 LFDGRRLRAEQTPDELEMED 375 LFDGRRLR EQTPDELEMED Sbjct: 63 LFDGRRLRGEQTPDELEMED 82 >ref|XP_011095446.1| PREDICTED: small ubiquitin-related modifier 1 isoform X4 [Sesamum indicum] gi|747095169|ref|XP_011095447.1| PREDICTED: small ubiquitin-related modifier 1 isoform X4 [Sesamum indicum] Length = 95 Score = 149 bits (377), Expect = 7e-45 Identities = 72/77 (93%), Positives = 73/77 (94%) Frame = +1 Query: 145 GQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD 324 GQ+EDKKP D S HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD Sbjct: 3 GQEEDKKPADASAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD 62 Query: 325 GRRLRAEQTPDELEMED 375 GRRLR EQTPDELEMED Sbjct: 63 GRRLRGEQTPDELEMED 79 >ref|XP_006401487.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] gi|557102577|gb|ESQ42940.1| hypothetical protein EUTSA_v10015094mg [Eutrema salsugineum] Length = 104 Score = 149 bits (377), Expect = 9e-45 Identities = 74/77 (96%), Positives = 75/77 (97%), Gaps = 1/77 (1%) Frame = +1 Query: 148 QDEDKKPGDQSG-HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD 324 Q+EDKKPGDQ G HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD Sbjct: 5 QEEDKKPGDQGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD 64 Query: 325 GRRLRAEQTPDELEMED 375 GRRLRAEQTPDELEMED Sbjct: 65 GRRLRAEQTPDELEMED 81 >ref|XP_008775626.1| PREDICTED: small ubiquitin-related modifier 2-like [Phoenix dactylifera] gi|743765655|ref|XP_010913055.1| PREDICTED: small ubiquitin-related modifier 2-like [Elaeis guineensis] Length = 102 Score = 149 bits (376), Expect = 1e-44 Identities = 72/81 (88%), Positives = 75/81 (92%) Frame = +1 Query: 133 MSTPGQDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 312 MS Q+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAAQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 313 FLFDGRRLRAEQTPDELEMED 375 FLFDGRRLR EQTPDELEME+ Sbjct: 61 FLFDGRRLRGEQTPDELEMEE 81 >ref|XP_008385845.1| PREDICTED: small ubiquitin-related modifier 1 [Malus domestica] gi|658047157|ref|XP_008359255.1| PREDICTED: small ubiquitin-related modifier 1 [Malus domestica] gi|694411589|ref|XP_009334152.1| PREDICTED: small ubiquitin-related modifier 1 [Pyrus x bretschneideri] Length = 98 Score = 149 bits (375), Expect = 2e-44 Identities = 72/76 (94%), Positives = 74/76 (97%) Frame = +1 Query: 148 QDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDG 327 Q+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+FNSIAFLFDG Sbjct: 7 QEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIAFLFDG 66 Query: 328 RRLRAEQTPDELEMED 375 RRLRAEQTPDELEMED Sbjct: 67 RRLRAEQTPDELEMED 82 >ref|XP_007212287.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] gi|645241250|ref|XP_008226991.1| PREDICTED: small ubiquitin-related modifier 1 [Prunus mume] gi|462408152|gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] Length = 98 Score = 149 bits (375), Expect = 2e-44 Identities = 72/76 (94%), Positives = 74/76 (97%) Frame = +1 Query: 148 QDEDKKPGDQSGHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDG 327 Q+EDKKP DQS HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+FNSIAFLFDG Sbjct: 7 QEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIAFLFDG 66 Query: 328 RRLRAEQTPDELEMED 375 RRLRAEQTPDELEMED Sbjct: 67 RRLRAEQTPDELEMED 82