BLASTX nr result
ID: Rehmannia28_contig00009289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009289 (343 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079571.1| PREDICTED: transmembrane protein 87A-like [S... 61 9e-09 ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [E... 55 1e-06 >ref|XP_011079571.1| PREDICTED: transmembrane protein 87A-like [Sesamum indicum] Length = 510 Score = 61.2 bits (147), Expect = 9e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +2 Query: 2 DDTLTLIKPSPLASKDVMSPQHRSAASGNGLPHGDLEGEEKTA 130 D+TL LIKPSPLASKDV SP+ RS SGNGL H DL+ EEKTA Sbjct: 469 DETLKLIKPSPLASKDVRSPELRSVGSGNGLSHTDLQ-EEKTA 510 >ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [Erythranthe guttata] gi|604347739|gb|EYU45894.1| hypothetical protein MIMGU_mgv1a004785mg [Erythranthe guttata] Length = 510 Score = 55.1 bits (131), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +2 Query: 2 DDTLTLIKPSPLASKDVMSPQHRSAASGNGLPHGDLEGEEKTA 130 DDTLTLIKPS + SKD+ SP+ RS NGLP GD+E EKTA Sbjct: 469 DDTLTLIKPSQVVSKDLKSPERRSVGPDNGLPEGDIE-LEKTA 510