BLASTX nr result
ID: Rehmannia28_contig00009206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00009206 (734 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829767.1| PREDICTED: hexokinase-1-like [Erythranthe gu... 60 4e-07 ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris] 57 8e-06 ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosi... 57 8e-06 gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum] 57 8e-06 ref|NP_001305619.1| hexokinase-1 [Solanum tuberosum] gi|11386876... 57 8e-06 >ref|XP_012829767.1| PREDICTED: hexokinase-1-like [Erythranthe guttata] gi|604347680|gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata] Length = 498 Score = 60.5 bits (145), Expect = 4e-07 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +1 Query: 529 SLFY*TREKLAKFVAEEEQILHQPPGNHEGIRFHFLIPCDANSIISGTFIRWSNGSS 699 +LF EKLA FVAEEEQI HQPPG + F F P SI SGT +RW+ G S Sbjct: 142 ALFDYIAEKLANFVAEEEQIFHQPPGKQRELGFTFSFPVMQTSINSGTLMRWTKGFS 198 >ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris] Length = 497 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = +1 Query: 526 QSLFY*TREKLAKFVAEEEQILHQPPGNHEGIRFHFLIPCDANSIISGTFIRWSNGSS 699 ++LF +LAKFVAEEE+ HQPPG + F F P SI SGT IRW+ G S Sbjct: 141 EALFDYIAAELAKFVAEEEEKFHQPPGKQRELGFTFSFPIMQTSINSGTLIRWTKGFS 198 >ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis] Length = 497 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = +1 Query: 526 QSLFY*TREKLAKFVAEEEQILHQPPGNHEGIRFHFLIPCDANSIISGTFIRWSNGSS 699 ++LF +LAKFVAEEE+ HQPPG + F F P SI SGT IRW+ G S Sbjct: 141 EALFDYIAAELAKFVAEEEERFHQPPGKQRELGFTFSFPIMQTSINSGTLIRWTKGFS 198 >gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum] Length = 497 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = +1 Query: 526 QSLFY*TREKLAKFVAEEEQILHQPPGNHEGIRFHFLIPCDANSIISGTFIRWSNGSS 699 ++LF +LAKFVAEEE+ HQPPG + F F P SI SGT IRW+ G S Sbjct: 141 EALFDYIAAELAKFVAEEEEKFHQPPGKQRELGFTFSFPIMQTSINSGTLIRWTKGFS 198 >ref|NP_001305619.1| hexokinase-1 [Solanum tuberosum] gi|11386876|sp|O64390.1|HXK1_SOLTU RecName: Full=Hexokinase-1; AltName: Full=StHK1 gi|3087888|emb|CAA63966.1| hexokinase [Solanum tuberosum] Length = 498 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +1 Query: 529 SLFY*TREKLAKFVAEEEQILHQPPGNHEGIRFHFLIPCDANSIISGTFIRWSNGSS 699 +LF +LAKFVA EE+ HQPPG + FH LIP +A+ SGT +RW+ G S Sbjct: 142 ALFDYIAAELAKFVAAEEEKFHQPPGKQRELGFHLLIPSNADFNNSGTIMRWTKGFS 198