BLASTX nr result
ID: Rehmannia28_contig00008423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00008423 (511 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHA80797.2| omega-3 fatty acid desaturase 7 [Chrysanthemum x ... 68 2e-10 gb|AGA84516.1| omega-3 fatty acid desaturase [Camellia sinensis] 68 2e-10 ref|XP_011019099.1| PREDICTED: omega-3 fatty acid desaturase, ch... 68 3e-10 gb|AHA80798.1| omega-3 fatty acid desaturase 7-2, partial [Chrys... 65 5e-10 ref|XP_012858283.1| PREDICTED: omega-3 fatty acid desaturase, ch... 67 6e-10 gb|KVI04856.1| Fatty acid desaturase, type 1 [Cynara cardunculus... 67 6e-10 gb|ABA55807.1| chloroplast omega-3 fatty acid desaturase precurs... 67 6e-10 gb|KVI09952.1| hypothetical protein Ccrd_011657 [Cynara carduncu... 67 6e-10 gb|AEK06372.1| plastid omega-3 desaturase FAD7/8 [Carthamus tinc... 67 6e-10 gb|AEK06371.1| plastid omega-3 desaturase FAD7/8 [Carthamus tinc... 67 6e-10 ref|XP_002309146.1| omega-3 desaturase family protein [Populus t... 67 6e-10 ref|XP_012850087.1| PREDICTED: omega-3 fatty acid desaturase, ch... 67 6e-10 ref|XP_011004760.1| PREDICTED: omega-3 fatty acid desaturase, ch... 67 6e-10 ref|XP_002323585.1| omega-3 desaturase family protein [Populus t... 67 6e-10 gb|ABK96470.1| unknown [Populus trichocarpa x Populus deltoides] 67 6e-10 gb|AHJ79158.1| plastid fatty acid desaturase [Juglans regia] 67 6e-10 gb|ABZ05395.1| fatty acid desaturase 3, partial [Arabidopsis tha... 62 7e-10 ref|XP_006429411.1| hypothetical protein CICLE_v10011691mg [Citr... 66 7e-10 gb|ABZ05387.1| fatty acid desaturase 3, partial [Arabidopsis tha... 62 7e-10 gb|ABZ05381.1| fatty acid desaturase 3, partial [Arabidopsis tha... 62 9e-10 >gb|AHA80797.2| omega-3 fatty acid desaturase 7 [Chrysanthemum x morifolium] Length = 428 Score = 67.8 bits (164), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHEEKLPWYRGK Sbjct: 299 GFVMWLDLVTYLHHHGHEEKLPWYRGK 325 >gb|AGA84516.1| omega-3 fatty acid desaturase [Camellia sinensis] Length = 438 Score = 67.8 bits (164), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHEEKLPWYRGK Sbjct: 305 GFVMWLDLVTYLHHHGHEEKLPWYRGK 331 >ref|XP_011019099.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Populus euphratica] Length = 451 Score = 67.8 bits (164), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHEEKLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEEKLPWYRGK 345 >gb|AHA80798.1| omega-3 fatty acid desaturase 7-2, partial [Chrysanthemum x morifolium] Length = 204 Score = 65.1 bits (157), Expect = 5e-10 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFV+WLDLVTYLHHHGHE+KLPWYRGK Sbjct: 151 GFVVWLDLVTYLHHHGHEDKLPWYRGK 177 >ref|XP_012858283.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Erythranthe guttata] gi|604300154|gb|EYU19997.1| hypothetical protein MIMGU_mgv1a006720mg [Erythranthe guttata] Length = 433 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 306 GFVMWLDLVTYLHHHGHEDKLPWYRGK 332 >gb|KVI04856.1| Fatty acid desaturase, type 1 [Cynara cardunculus var. scolymus] Length = 438 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 307 GFVMWLDLVTYLHHHGHEDKLPWYRGK 333 >gb|ABA55807.1| chloroplast omega-3 fatty acid desaturase precursor [Crepis alpina] Length = 438 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 307 GFVMWLDLVTYLHHHGHEDKLPWYRGK 333 >gb|KVI09952.1| hypothetical protein Ccrd_011657 [Cynara cardunculus var. scolymus] Length = 440 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 313 GFVMWLDLVTYLHHHGHEDKLPWYRGK 339 >gb|AEK06372.1| plastid omega-3 desaturase FAD7/8 [Carthamus tinctorius] Length = 440 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 312 GFVMWLDLVTYLHHHGHEDKLPWYRGK 338 >gb|AEK06371.1| plastid omega-3 desaturase FAD7/8 [Carthamus tinctorius] Length = 441 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 314 GFVMWLDLVTYLHHHGHEDKLPWYRGK 340 >ref|XP_002309146.1| omega-3 desaturase family protein [Populus trichocarpa] gi|222855122|gb|EEE92669.1| omega-3 desaturase family protein [Populus trichocarpa] Length = 451 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEDKLPWYRGK 345 >ref|XP_012850087.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Erythranthe guttata] gi|604313618|gb|EYU26787.1| hypothetical protein MIMGU_mgv1a006242mg [Erythranthe guttata] Length = 451 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEDKLPWYRGK 345 >ref|XP_011004760.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic-like [Populus euphratica] Length = 452 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEDKLPWYRGK 345 >ref|XP_002323585.1| omega-3 desaturase family protein [Populus trichocarpa] gi|222868215|gb|EEF05346.1| omega-3 desaturase family protein [Populus trichocarpa] Length = 452 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEDKLPWYRGK 345 >gb|ABK96470.1| unknown [Populus trichocarpa x Populus deltoides] Length = 452 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 319 GFVMWLDLVTYLHHHGHEDKLPWYRGK 345 >gb|AHJ79158.1| plastid fatty acid desaturase [Juglans regia] Length = 455 Score = 66.6 bits (161), Expect = 6e-10 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 510 GFVMWLDLVTYLHHHGHEEKLPWYRGK 430 GFVMWLDLVTYLHHHGHE+KLPWYRGK Sbjct: 323 GFVMWLDLVTYLHHHGHEDKLPWYRGK 349 >gb|ABZ05395.1| fatty acid desaturase 3, partial [Arabidopsis thaliana] Length = 100 Score = 62.4 bits (150), Expect = 7e-10 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 507 FVMWLDLVTYLHHHGHEEKLPWYRGK 430 FVMWLD VTYLHHHGH+EKLPWYRGK Sbjct: 55 FVMWLDAVTYLHHHGHDEKLPWYRGK 80 >ref|XP_006429411.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|567873645|ref|XP_006429412.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|557531468|gb|ESR42651.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] gi|557531469|gb|ESR42652.1| hypothetical protein CICLE_v10011691mg [Citrus clementina] Length = 354 Score = 66.2 bits (160), Expect = 7e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 507 FVMWLDLVTYLHHHGHEEKLPWYRGKVKST 418 FVMWLDLVTYLHHHGHE+KLPWYRGKV T Sbjct: 325 FVMWLDLVTYLHHHGHEDKLPWYRGKVGVT 354 >gb|ABZ05387.1| fatty acid desaturase 3, partial [Arabidopsis thaliana] gi|167018842|gb|ABZ05391.1| fatty acid desaturase 3, partial [Arabidopsis thaliana] Length = 102 Score = 62.4 bits (150), Expect = 7e-10 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 507 FVMWLDLVTYLHHHGHEEKLPWYRGK 430 FVMWLD VTYLHHHGH+EKLPWYRGK Sbjct: 55 FVMWLDAVTYLHHHGHDEKLPWYRGK 80 >gb|ABZ05381.1| fatty acid desaturase 3, partial [Arabidopsis thaliana] Length = 110 Score = 62.4 bits (150), Expect = 9e-10 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 507 FVMWLDLVTYLHHHGHEEKLPWYRGK 430 FVMWLD VTYLHHHGH+EKLPWYRGK Sbjct: 47 FVMWLDAVTYLHHHGHDEKLPWYRGK 72