BLASTX nr result
ID: Rehmannia28_contig00007260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00007260 (336 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [S... 67 6e-11 >ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [Sesamum indicum] Length = 333 Score = 67.0 bits (162), Expect = 6e-11 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -2 Query: 134 MTTLNSFFSPASQFIQPKKHFRLSISPSYHISTISKRFLNPNL 6 MTTLN+F SP SQ +PKKHF L ISPS+H+ T+SK FLNPNL Sbjct: 2 MTTLNNFLSPTSQLTEPKKHFSLPISPSHHLFTLSKPFLNPNL 44