BLASTX nr result
ID: Rehmannia28_contig00007236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00007236 (456 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH62317.1| hypothetical protein GLYMA_04G099900 [Glycine max] 64 4e-10 gb|KRH53028.1| hypothetical protein GLYMA_06G101500 [Glycine max] 64 4e-10 ref|XP_008466219.1| PREDICTED: 14-3-3-like protein [Cucumis melo] 65 7e-10 ref|XP_004136278.1| PREDICTED: 14-3-3-like protein [Cucumis sati... 65 7e-10 ref|XP_007018723.1| General regulatory factor 2, OMEGA [Theobrom... 65 7e-10 gb|KRH62316.1| hypothetical protein GLYMA_04G099900 [Glycine max] 64 1e-09 gb|KRH53027.1| hypothetical protein GLYMA_06G101500 [Glycine max] 64 1e-09 gb|KVH98545.1| 14-3-3 domain-containing protein [Cynara carduncu... 64 1e-09 ref|XP_007136271.1| hypothetical protein PHAVU_009G032500g [Phas... 64 1e-09 ref|XP_014501534.1| PREDICTED: 14-3-3-like protein isoform X1 [V... 64 1e-09 ref|XP_003526571.1| PREDICTED: 14-3-3-like protein [Glycine max]... 64 1e-09 ref|NP_001238389.1| 14-3-3 protein SGF14h [Glycine max] gi|31693... 64 1e-09 gb|KYP44394.1| 14-3-3-like protein [Cajanus cajan] 64 1e-09 ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera] gi|226295434... 64 1e-09 ref|XP_012571686.1| PREDICTED: 14-3-3-like protein [Cicer arieti... 64 1e-09 gb|ACQ45021.1| 14-3-3 [Cicer arietinum] 64 1e-09 ref|XP_015885299.1| PREDICTED: 14-3-3-like protein [Ziziphus juj... 64 1e-09 ref|XP_006472571.1| PREDICTED: 14-3-3-like protein [Citrus sinen... 64 1e-09 gb|KRH53025.1| hypothetical protein GLYMA_06G101500 [Glycine max] 64 1e-09 gb|KRH62315.1| hypothetical protein GLYMA_04G099900 [Glycine max] 64 2e-09 >gb|KRH62317.1| hypothetical protein GLYMA_04G099900 [Glycine max] Length = 172 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|KRH53028.1| hypothetical protein GLYMA_06G101500 [Glycine max] Length = 176 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_008466219.1| PREDICTED: 14-3-3-like protein [Cucumis melo] Length = 258 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLISSA+ GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLISSAASGDSKVFYLKMKGDYHRYL 138 >ref|XP_004136278.1| PREDICTED: 14-3-3-like protein [Cucumis sativus] gi|700205092|gb|KGN60225.1| hypothetical protein Csa_3G889810 [Cucumis sativus] Length = 258 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLISSA+ GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLISSAASGDSKVFYLKMKGDYHRYL 138 >ref|XP_007018723.1| General regulatory factor 2, OMEGA [Theobroma cacao] gi|508724051|gb|EOY15948.1| General regulatory factor 2, OMEGA [Theobroma cacao] Length = 267 Score = 65.1 bits (157), Expect = 7e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASAGDSKVFYLKMKGDYHRYL 138 >gb|KRH62316.1| hypothetical protein GLYMA_04G099900 [Glycine max] Length = 234 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|KRH53027.1| hypothetical protein GLYMA_06G101500 [Glycine max] Length = 234 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|KVH98545.1| 14-3-3 domain-containing protein [Cynara cardunculus var. scolymus] Length = 259 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 98 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 133 >ref|XP_007136271.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris] gi|593268189|ref|XP_007136272.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris] gi|543176851|gb|AGV54448.1| 14-3-3 protein [Phaseolus vulgaris] gi|561009358|gb|ESW08265.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris] gi|561009359|gb|ESW08266.1| hypothetical protein PHAVU_009G032500g [Phaseolus vulgaris] Length = 259 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_014501534.1| PREDICTED: 14-3-3-like protein isoform X1 [Vigna radiata var. radiata] gi|13928452|dbj|BAB47119.1| 14-3-3 protein [Vigna angularis] gi|920698504|gb|KOM41729.1| hypothetical protein LR48_Vigan04g192700 [Vigna angularis] gi|965662792|dbj|BAT78501.1| hypothetical protein VIGAN_02118500 [Vigna angularis var. angularis] Length = 259 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_003526571.1| PREDICTED: 14-3-3-like protein [Glycine max] gi|947104643|gb|KRH53026.1| hypothetical protein GLYMA_06G101500 [Glycine max] Length = 259 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|NP_001238389.1| 14-3-3 protein SGF14h [Glycine max] gi|316937084|gb|ADU60526.1| SGF14h [Glycine max] gi|734372206|gb|KHN19782.1| 14-3-3-like protein [Glycine soja] Length = 259 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|KYP44394.1| 14-3-3-like protein [Cajanus cajan] Length = 260 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|NP_001267852.1| 14-3-3 protein [Vitis vinifera] gi|226295434|gb|ACO40495.1| 14-3-3 protein [Vitis vinifera] Length = 260 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_012571686.1| PREDICTED: 14-3-3-like protein [Cicer arietinum] Length = 261 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|ACQ45021.1| 14-3-3 [Cicer arietinum] Length = 261 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_015885299.1| PREDICTED: 14-3-3-like protein [Ziziphus jujuba] Length = 264 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >ref|XP_006472571.1| PREDICTED: 14-3-3-like protein [Citrus sinensis] Length = 265 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 108 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 143 >gb|KRH53025.1| hypothetical protein GLYMA_06G101500 [Glycine max] Length = 279 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138 >gb|KRH62315.1| hypothetical protein GLYMA_04G099900 [Glycine max] Length = 288 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 349 CDDIVKLLDKRLISSASVGDSKVFHLKMKGDYHRYL 456 CD I+KLLD RLI SAS GDSKVF+LKMKGDYHRYL Sbjct: 103 CDGILKLLDSRLIPSASSGDSKVFYLKMKGDYHRYL 138