BLASTX nr result
ID: Rehmannia28_contig00006624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00006624 (386 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRX71054.1| Proteasome subunit alpha type-3, partial [Trichin... 52 1e-06 ref|XP_007202361.1| hypothetical protein PRUPE_ppa009201mg [Prun... 55 2e-06 ref|XP_006294674.1| hypothetical protein CARUB_v10023709mg, part... 55 2e-06 gb|KMS94763.1| hypothetical protein BVRB_015520, partial [Beta v... 52 2e-06 gb|KFK43151.1| hypothetical protein AALP_AA1G086600, partial [Ar... 52 2e-06 ref|XP_009592267.1| PREDICTED: proteasome subunit alpha type-3-l... 50 6e-06 gb|AFK44367.1| unknown [Lotus japonicus] 52 6e-06 ref|XP_010668272.1| PREDICTED: proteasome subunit alpha type-3-l... 52 1e-05 >gb|KRX71054.1| Proteasome subunit alpha type-3, partial [Trichinella patagoniensis] Length = 44 Score = 51.6 bits (122), Expect = 1e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 MSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQI 24 >ref|XP_007202361.1| hypothetical protein PRUPE_ppa009201mg [Prunus persica] gi|462397892|gb|EMJ03560.1| hypothetical protein PRUPE_ppa009201mg [Prunus persica] Length = 302 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 286 SNRKQCKGKMSSIGTGYDLSVTTFSPDGRVFQI 384 +N + + KMSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 45 NNTRPKRRKMSSIGTGYDLSVTTFSPDGRVFQI 77 >ref|XP_006294674.1| hypothetical protein CARUB_v10023709mg, partial [Capsella rubella] gi|482563382|gb|EOA27572.1| hypothetical protein CARUB_v10023709mg, partial [Capsella rubella] Length = 304 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = +1 Query: 286 SNRKQCKGKMSSIGTGYDLSVTTFSPDGRVFQI 384 S Q KMSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 47 SRNNQRSRKMSSIGTGYDLSVTTFSPDGRVFQI 79 >gb|KMS94763.1| hypothetical protein BVRB_015520, partial [Beta vulgaris subsp. vulgaris] Length = 76 Score = 51.6 bits (122), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 MSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQI 24 >gb|KFK43151.1| hypothetical protein AALP_AA1G086600, partial [Arabis alpina] Length = 76 Score = 51.6 bits (122), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 MSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQI 24 >ref|XP_009592267.1| PREDICTED: proteasome subunit alpha type-3-like [Nicotiana tomentosiformis] Length = 78 Score = 50.4 bits (119), Expect = 6e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 M+SIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MASIGTGYDLSVTTFSPDGRVFQI 24 >gb|AFK44367.1| unknown [Lotus japonicus] Length = 127 Score = 51.6 bits (122), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 MSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQI 24 >ref|XP_010668272.1| PREDICTED: proteasome subunit alpha type-3-like, partial [Beta vulgaris subsp. vulgaris] Length = 154 Score = 51.6 bits (122), Expect = 1e-05 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 MSSIGTGYDLSVTTFSPDGRVFQI 384 MSSIGTGYDLSVTTFSPDGRVFQI Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQI 24