BLASTX nr result
ID: Rehmannia28_contig00005985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005985 (613 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37019.1| hypothetical protein MIMGU_mgv1a003319mg [Erythra... 59 9e-07 ref|XP_012838003.1| PREDICTED: uncharacterized protein LOC105958... 59 1e-06 ref|XP_012838002.1| PREDICTED: uncharacterized protein LOC105958... 59 1e-06 gb|KMS96409.1| hypothetical protein BVRB_9g225340 [Beta vulgaris... 58 2e-06 ref|XP_010666013.1| PREDICTED: uncharacterized protein LOC104883... 58 2e-06 ref|XP_011088805.1| PREDICTED: uncharacterized protein LOC105169... 57 4e-06 >gb|EYU37019.1| hypothetical protein MIMGU_mgv1a003319mg [Erythranthe guttata] Length = 592 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYFIQ 524 KCAE+LV+G GKCPMC APVVE VRAYFIQ Sbjct: 563 KCAEKLVEGAGKCPMCHAPVVEVVRAYFIQ 592 >ref|XP_012838003.1| PREDICTED: uncharacterized protein LOC105958548 isoform X2 [Erythranthe guttata] Length = 693 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYFIQ 524 KCAE+LV+G GKCPMC APVVE VRAYFIQ Sbjct: 664 KCAEKLVEGAGKCPMCHAPVVEVVRAYFIQ 693 >ref|XP_012838002.1| PREDICTED: uncharacterized protein LOC105958548 isoform X1 [Erythranthe guttata] Length = 696 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYFIQ 524 KCAE+LV+G GKCPMC APVVE VRAYFIQ Sbjct: 667 KCAEKLVEGAGKCPMCHAPVVEVVRAYFIQ 696 >gb|KMS96409.1| hypothetical protein BVRB_9g225340 [Beta vulgaris subsp. vulgaris] Length = 826 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYFIQ 524 KCA+ LVQG GKCPMCQAPV+E +RAYFIQ Sbjct: 797 KCADLLVQGNGKCPMCQAPVIEVIRAYFIQ 826 >ref|XP_010666013.1| PREDICTED: uncharacterized protein LOC104883229 [Beta vulgaris subsp. vulgaris] Length = 828 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYFIQ 524 KCA+ LVQG GKCPMCQAPV+E +RAYFIQ Sbjct: 799 KCADLLVQGNGKCPMCQAPVIEVIRAYFIQ 828 >ref|XP_011088805.1| PREDICTED: uncharacterized protein LOC105169955 isoform X1 [Sesamum indicum] gi|747082921|ref|XP_011088806.1| PREDICTED: uncharacterized protein LOC105169955 isoform X1 [Sesamum indicum] Length = 859 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 613 KCAERLVQGPGKCPMCQAPVVEAVRAYF 530 KCAE+LVQG KCPMCQAPVVEAVRAYF Sbjct: 830 KCAEKLVQGTRKCPMCQAPVVEAVRAYF 857