BLASTX nr result
ID: Rehmannia28_contig00005963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005963 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843072.1| PREDICTED: uncharacterized protein LOC105963... 54 5e-06 >ref|XP_012843072.1| PREDICTED: uncharacterized protein LOC105963230 [Erythranthe guttata] gi|604322447|gb|EYU32833.1| hypothetical protein MIMGU_mgv1a009899mg [Erythranthe guttata] Length = 328 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/49 (51%), Positives = 31/49 (63%) Frame = +2 Query: 176 RISPSPKQIPSPCCFLKLNHTKNNPFLSTSSPLSNGHLSKPSLLVVKAS 322 R +PSPK P PCC LKLNH + + +S+ N H SK S+L VKAS Sbjct: 18 RATPSPKLNPPPCCLLKLNHHSKSQYPLSSTTFCNAHSSKASILAVKAS 66