BLASTX nr result
ID: Rehmannia28_contig00005956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005956 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001291340.1| probable tocopherol cyclase, chloroplastic [... 58 3e-07 ref|XP_012857904.1| PREDICTED: tocopherol cyclase, chloroplastic... 54 5e-06 >ref|NP_001291340.1| probable tocopherol cyclase, chloroplastic [Sesamum indicum] gi|159792908|gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum] Length = 494 Score = 57.8 bits (138), Expect = 3e-07 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -3 Query: 154 PCFNPLTTPLKTASGLPFSPAELRFRKKSQGLFAVKSVLKADSINSSIVNE 2 PCFN L P K A+ L FS ELRF KK + FAVKSV ADSI+SS+V+E Sbjct: 11 PCFNSLMIPHKAAARLQFSAPELRFGKKFRHPFAVKSVFGADSISSSLVDE 61 >ref|XP_012857904.1| PREDICTED: tocopherol cyclase, chloroplastic [Erythranthe guttata] gi|604300629|gb|EYU20447.1| hypothetical protein MIMGU_mgv1a005177mg [Erythranthe guttata] Length = 494 Score = 54.3 bits (129), Expect = 5e-06 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -3 Query: 157 NPCFNPLTTPLKTASGLPFSPAE-LRFRKKSQGLFAVKSVLKADSINS 17 NPC NP + PLK A+ PFSP E LR RKKS FAVKSVLK D ++S Sbjct: 10 NPCLNPCSFPLKPAARPPFSPPELLRPRKKSHRPFAVKSVLKYDPLDS 57