BLASTX nr result
ID: Rehmannia28_contig00005679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005679 (612 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432011.1| hypothetical protein CICLE_v10003098mg [Citr... 57 5e-07 >ref|XP_006432011.1| hypothetical protein CICLE_v10003098mg [Citrus clementina] gi|557534133|gb|ESR45251.1| hypothetical protein CICLE_v10003098mg [Citrus clementina] Length = 182 Score = 57.4 bits (137), Expect = 5e-07 Identities = 32/67 (47%), Positives = 41/67 (61%) Frame = -2 Query: 437 QVEKFDGRVEFGLWQV*VNDVMVQSGLHKAYKALKVNCQSGGGVDLANSS*SGLTLWQWR 258 ++EKFDGR+ FGLWQV V DV++QSGLHKA K G A++S SG T + Sbjct: 13 EIEKFDGRINFGLWQVQVKDVLIQSGLHKALK---------GKPSPASNSGSGKTTKELW 63 Query: 257 FSREKMY 237 EK+Y Sbjct: 64 EKLEKLY 70