BLASTX nr result
ID: Rehmannia28_contig00005632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005632 (343 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079571.1| PREDICTED: transmembrane protein 87A-like [S... 64 1e-09 ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [E... 57 2e-07 >ref|XP_011079571.1| PREDICTED: transmembrane protein 87A-like [Sesamum indicum] Length = 510 Score = 63.5 bits (153), Expect = 1e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +2 Query: 2 DDTLTLIKPSPLASKDVMSPQHRSAGSGNGLPHGDLEGEEKTA 130 D+TL LIKPSPLASKDV SP+ RS GSGNGL H DL+ EEKTA Sbjct: 469 DETLKLIKPSPLASKDVRSPELRSVGSGNGLSHTDLQ-EEKTA 510 >ref|XP_012831211.1| PREDICTED: transmembrane protein 87A-like [Erythranthe guttata] gi|604347739|gb|EYU45894.1| hypothetical protein MIMGU_mgv1a004785mg [Erythranthe guttata] Length = 510 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +2 Query: 2 DDTLTLIKPSPLASKDVMSPQHRSAGSGNGLPHGDLEGEEKTA 130 DDTLTLIKPS + SKD+ SP+ RS G NGLP GD+E EKTA Sbjct: 469 DDTLTLIKPSQVVSKDLKSPERRSVGPDNGLPEGDIE-LEKTA 510