BLASTX nr result
ID: Rehmannia28_contig00005398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005398 (368 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008776254.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 92 6e-22 ref|XP_010943947.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 91 2e-21 ref|XP_008789762.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 91 3e-21 ref|XP_010929057.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 91 3e-21 ref|XP_011096338.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 89 9e-21 gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] 89 1e-20 ref|XP_012444566.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 89 2e-20 ref|XP_010052292.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 89 2e-20 gb|EPS67742.1| hypothetical protein M569_07033 [Genlisea aurea] 88 2e-20 ref|XP_011086050.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 88 4e-20 ref|XP_010272386.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 87 7e-20 ref|XP_012848645.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 87 8e-20 ref|XP_012830349.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 87 1e-19 gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] 87 1e-19 gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Maniho... 85 1e-19 ref|XP_009397192.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 86 2e-19 gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] 86 2e-19 ref|XP_012450091.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 86 2e-19 ref|XP_006858256.1| PREDICTED: auxin-repressed 12.5 kDa protein ... 86 3e-19 ref|XP_015956441.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 86 3e-19 >ref|XP_008776254.1| PREDICTED: auxin-repressed 12.5 kDa protein [Phoenix dactylifera] Length = 120 Score = 92.4 bits (228), Expect = 6e-22 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK+IGSNYFDKPQPNSPTVYDWLYSGETRS HR Sbjct: 78 SVFNPGSNLATKNIGSNYFDKPQPNSPTVYDWLYSGETRSNHR 120 >ref|XP_010943947.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Elaeis guineensis] gi|353441188|gb|AEQ94178.1| auxin-repressed protein [Elaeis guineensis] Length = 123 Score = 91.3 bits (225), Expect = 2e-21 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK+IG+NYFDKPQPNSPTVYDWLYSGETRS HR Sbjct: 81 SVFNPGSNLATKTIGANYFDKPQPNSPTVYDWLYSGETRSNHR 123 >ref|XP_008789762.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Phoenix dactylifera] Length = 116 Score = 90.5 bits (223), Expect = 3e-21 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK++G+NYFDKPQPNSPTVYDWLYSGETRS HR Sbjct: 74 SVFNPGSNLATKTVGANYFDKPQPNSPTVYDWLYSGETRSTHR 116 >ref|XP_010929057.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Elaeis guineensis] Length = 119 Score = 90.5 bits (223), Expect = 3e-21 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK++G+NYFDKPQPNSPTVYDWLYSGETRS HR Sbjct: 77 SVFNPGSNLATKTVGANYFDKPQPNSPTVYDWLYSGETRSTHR 119 >ref|XP_011096338.1| PREDICTED: auxin-repressed 12.5 kDa protein [Sesamum indicum] Length = 119 Score = 89.4 bits (220), Expect = 9e-21 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK++GS YFDKPQPNSPTVYDWLYSG+TRS+HR Sbjct: 77 SVFNPGSNLATKNVGSEYFDKPQPNSPTVYDWLYSGDTRSRHR 119 >gb|ADO32740.1| auxin-repressed protein [Camellia sinensis] Length = 118 Score = 89.0 bits (219), Expect = 1e-20 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK IGS+ FDKPQPNSPTVYDWLYSGETRSKHR Sbjct: 76 SVFNPGSNLATKGIGSDVFDKPQPNSPTVYDWLYSGETRSKHR 118 >ref|XP_012444566.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X2 [Gossypium raimondii] Length = 117 Score = 88.6 bits (218), Expect = 2e-20 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSNLATKSIGS+ FDKPQPNSPTVYDWLYSGETRSKHR Sbjct: 75 SVFHPGSNLATKSIGSDVFDKPQPNSPTVYDWLYSGETRSKHR 117 >ref|XP_010052292.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Eucalyptus grandis] Length = 122 Score = 88.6 bits (218), Expect = 2e-20 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK IG YFDKPQPNSPTVYDWLYSGETRS+HR Sbjct: 80 SVFNPGSNLATKKIGGEYFDKPQPNSPTVYDWLYSGETRSQHR 122 >gb|EPS67742.1| hypothetical protein M569_07033 [Genlisea aurea] Length = 117 Score = 88.2 bits (217), Expect = 2e-20 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSNLATK+IG++YFD+PQPNSPTVYDWLYSGETRSKHR Sbjct: 75 SVFHPGSNLATKTIGADYFDRPQPNSPTVYDWLYSGETRSKHR 117 >ref|XP_011086050.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Sesamum indicum] Length = 118 Score = 87.8 bits (216), Expect = 4e-20 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSNLATKSIG++YFD+PQPNSPTVYDWLYSGETRSKH+ Sbjct: 76 SVFHPGSNLATKSIGADYFDRPQPNSPTVYDWLYSGETRSKHQ 118 >ref|XP_010272386.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Nelumbo nucifera] Length = 119 Score = 87.0 bits (214), Expect = 7e-20 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATKS+G+ FDKPQPNSPTVYDWLYSG+TRSKHR Sbjct: 77 SVFNPGSNLATKSLGTEMFDKPQPNSPTVYDWLYSGDTRSKHR 119 >ref|XP_012848645.1| PREDICTED: auxin-repressed 12.5 kDa protein [Erythranthe guttata] gi|604315291|gb|EYU27997.1| hypothetical protein MIMGU_mgv1a016396mg [Erythranthe guttata] Length = 123 Score = 87.0 bits (214), Expect = 8e-20 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK++GS+YFDKPQ N+PTVYDW+YSGETRSKHR Sbjct: 81 SVFNPGSNLATKNVGSDYFDKPQANAPTVYDWMYSGETRSKHR 123 >ref|XP_012830349.1| PREDICTED: auxin-repressed 12.5 kDa protein [Erythranthe guttata] gi|604344627|gb|EYU43381.1| hypothetical protein MIMGU_mgv1a016425mg [Erythranthe guttata] Length = 122 Score = 86.7 bits (213), Expect = 1e-19 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSNLATK+IG++YFDKPQPNSPTVYDWLYSG+TRSKH+ Sbjct: 80 SVFHPGSNLATKTIGTDYFDKPQPNSPTVYDWLYSGDTRSKHQ 122 >gb|ABW74471.1| auxin-repressed protein [Paeonia suffruticosa] Length = 126 Score = 86.7 bits (213), Expect = 1e-19 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKH 126 SVFNPGSNLAT+ IGSN FDKPQPNSPTVYDWLYSG+TRSKH Sbjct: 83 SVFNPGSNLATRGIGSNVFDKPQPNSPTVYDWLYSGDTRSKH 124 >gb|AAX84678.1| auxin-repressed protein-like protein ARP2 [Manihot esculenta] Length = 68 Score = 84.7 bits (208), Expect = 1e-19 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSNLATK +G+ FDKPQPNSPTVYDWLYSGETRSKHR Sbjct: 26 SVFHPGSNLATKGLGAQLFDKPQPNSPTVYDWLYSGETRSKHR 68 >ref|XP_009397192.1| PREDICTED: auxin-repressed 12.5 kDa protein [Musa acuminata subsp. malaccensis] Length = 117 Score = 85.9 bits (211), Expect = 2e-19 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK++G+N FDKPQPNSPTVYDWLYSGET+S HR Sbjct: 75 SVFNPGSNLATKTLGANLFDKPQPNSPTVYDWLYSGETKSTHR 117 >gb|AAW02792.1| dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 85.9 bits (211), Expect = 2e-19 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK +GS FDKP+PNSPTVYDWLYSGETRSKHR Sbjct: 77 SVFNPGSNLATKGLGSALFDKPEPNSPTVYDWLYSGETRSKHR 119 >ref|XP_012450091.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X2 [Gossypium raimondii] gi|763799419|gb|KJB66374.1| hypothetical protein B456_010G155600 [Gossypium raimondii] Length = 111 Score = 85.5 bits (210), Expect = 2e-19 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKH 126 SVFNPGSNLATK IG+ FDKPQPNSPTVYDWLYSGETRSKH Sbjct: 68 SVFNPGSNLATKGIGAEVFDKPQPNSPTVYDWLYSGETRSKH 109 >ref|XP_006858256.1| PREDICTED: auxin-repressed 12.5 kDa protein [Amborella trichopoda] gi|548862359|gb|ERN19723.1| hypothetical protein AMTR_s00062p00206330 [Amborella trichopoda] Length = 120 Score = 85.5 bits (210), Expect = 3e-19 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVFNPGSNLATK+IG+ FDKPQPNSPTVYDWLYSG+TRS+HR Sbjct: 78 SVFNPGSNLATKTIGAEVFDKPQPNSPTVYDWLYSGDTRSRHR 120 >ref|XP_015956441.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Arachis duranensis] Length = 121 Score = 85.5 bits (210), Expect = 3e-19 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +1 Query: 1 SVFNPGSNLATKSIGSNYFDKPQPNSPTVYDWLYSGETRSKHR 129 SVF+PGSN ATK+IGS+YFDKP PNSPTVYDWLYSGETRSKHR Sbjct: 79 SVFHPGSNSATKTIGSDYFDKPLPNSPTVYDWLYSGETRSKHR 121