BLASTX nr result
ID: Rehmannia28_contig00005117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005117 (470 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082676.1| PREDICTED: cytochrome c oxidase copper chape... 121 3e-33 emb|CDP05919.1| unnamed protein product [Coffea canephora] 117 8e-32 ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chape... 116 2e-31 ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chape... 115 7e-31 ref|XP_012441468.1| PREDICTED: cytochrome c oxidase copper chape... 114 1e-30 ref|XP_009626764.1| PREDICTED: cytochrome c oxidase copper chape... 114 1e-30 ref|XP_007021481.1| Cytochrome C oxidase copper chaperone isofor... 113 4e-30 ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chape... 113 4e-30 ref|XP_015582429.1| PREDICTED: cytochrome c oxidase copper chape... 112 8e-30 ref|XP_003540108.1| PREDICTED: cytochrome c oxidase copper chape... 112 8e-30 ref|XP_007021482.1| Cytochrome C oxidase copper chaperone isofor... 113 9e-30 ref|XP_007152970.1| hypothetical protein PHAVU_004G175600g [Phas... 112 1e-29 gb|KYP42360.1| Cytochrome c oxidase copper chaperone [Cajanus ca... 111 2e-29 ref|XP_003527251.1| PREDICTED: cytochrome c oxidase copper chape... 110 3e-29 ref|XP_012848739.1| PREDICTED: cytochrome c oxidase copper chape... 110 3e-29 dbj|BAU02939.1| hypothetical protein VIGAN_11253600 [Vigna angul... 110 7e-29 ref|XP_012084961.1| PREDICTED: cytochrome c oxidase copper chape... 110 7e-29 ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citr... 110 7e-29 ref|XP_010112978.1| Cytochrome c oxidase copper chaperone [Morus... 109 1e-28 ref|XP_010273248.1| PREDICTED: cytochrome c oxidase copper chape... 109 1e-28 >ref|XP_011082676.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Sesamum indicum] gi|747071599|ref|XP_011082679.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Sesamum indicum] Length = 80 Score = 121 bits (303), Expect = 3e-33 Identities = 59/80 (73%), Positives = 62/80 (77%), Gaps = 1/80 (1%) Frame = +1 Query: 28 MGGXXXXXXXXXXXXXXXKDQ-GSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGES 204 MGG KDQ GST+V+S PDSKPKK+ICCACPDTKKLRDECIVEHGES Sbjct: 1 MGGLSIQNSSSIVSLQSQKDQQGSTAVTSAPDSKPKKKICCACPDTKKLRDECIVEHGES 60 Query: 205 ACEKWIEAHRKCLRAEGFNV 264 ACEKWIEAHRK LRAEGFNV Sbjct: 61 ACEKWIEAHRKFLRAEGFNV 80 >emb|CDP05919.1| unnamed protein product [Coffea canephora] Length = 79 Score = 117 bits (293), Expect = 8e-32 Identities = 53/79 (67%), Positives = 58/79 (73%) Frame = +1 Query: 28 MGGXXXXXXXXXXXXXXXKDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESA 207 MGG KDQ SV GPDSKP+K+ICCACP+TKKLRDEC+VEHGE+A Sbjct: 1 MGGLPAQNSSSVISLNVHKDQSPGSVGPGPDSKPRKKICCACPETKKLRDECVVEHGEAA 60 Query: 208 CEKWIEAHRKCLRAEGFNV 264 C KWIEAHRKCLRAEGFNV Sbjct: 61 CGKWIEAHRKCLRAEGFNV 79 >ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|449431846|ref|XP_004133711.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|778676325|ref|XP_011650564.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|700201111|gb|KGN56244.1| Cytochrome c oxidase copper chaperone [Cucumis sativus] Length = 80 Score = 116 bits (291), Expect = 2e-31 Identities = 51/60 (85%), Positives = 53/60 (88%) Frame = +1 Query: 85 DQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 DQ ST + S PD KPKK+ICCACPDTKKLRDECIVEHGE AC KWIEAHRKCLRAEGFNV Sbjct: 21 DQASTVIKSTPDGKPKKKICCACPDTKKLRDECIVEHGEEACGKWIEAHRKCLRAEGFNV 80 >ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Solanum tuberosum] gi|971578452|ref|XP_015158724.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Solanum tuberosum] Length = 79 Score = 115 bits (287), Expect = 7e-31 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 KDQ ST+ S+ PDSKPKK+ICCACP+TKKLRDECIVEHGESACEKWIEAHRKCLRAEGF Sbjct: 20 KDQKSTA-STMPDSKPKKKICCACPETKKLRDECIVEHGESACEKWIEAHRKCLRAEGFK 78 Query: 262 V 264 V Sbjct: 79 V 79 >ref|XP_012441468.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Gossypium raimondii] gi|763794884|gb|KJB61880.1| hypothetical protein B456_009G388100 [Gossypium raimondii] Length = 79 Score = 114 bits (286), Expect = 1e-30 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = +1 Query: 85 DQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 ++GST+ +SGP+SKPKK+ICCACP+TKKLRDECIVEHGE AC KWIEAHR CLRAEGFNV Sbjct: 20 NRGSTTATSGPESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRICLRAEGFNV 79 >ref|XP_009626764.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Nicotiana tomentosiformis] gi|697145272|ref|XP_009626766.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Nicotiana tomentosiformis] Length = 76 Score = 114 bits (285), Expect = 1e-30 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +1 Query: 106 SSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 S+ PDSKPKK+ICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV Sbjct: 24 SAVPDSKPKKKICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 76 >ref|XP_007021481.1| Cytochrome C oxidase copper chaperone isoform 1 [Theobroma cacao] gi|508721109|gb|EOY13006.1| Cytochrome C oxidase copper chaperone isoform 1 [Theobroma cacao] Length = 78 Score = 113 bits (282), Expect = 4e-30 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +1 Query: 97 TSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 ++V+SGP+SKPKK+ICCACP+TKKLRDECIVEHGE AC KWIEAHRKCLRAEGFNV Sbjct: 23 SAVTSGPESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV 78 >ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|460405601|ref|XP_004248264.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|723734545|ref|XP_010327136.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|723734550|ref|XP_010327137.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|970058821|ref|XP_015056122.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum pennellii] gi|970058823|ref|XP_015056123.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum pennellii] gi|970058825|ref|XP_015056124.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum pennellii] Length = 79 Score = 113 bits (282), Expect = 4e-30 Identities = 52/61 (85%), Positives = 56/61 (91%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 KDQ S + S+ PDSKPKK+ICCACP+TKKLRDECIVEHGESACEKWIEAHRKCLRAEGF Sbjct: 20 KDQKSAA-STMPDSKPKKKICCACPETKKLRDECIVEHGESACEKWIEAHRKCLRAEGFK 78 Query: 262 V 264 V Sbjct: 79 V 79 >ref|XP_015582429.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Ricinus communis] gi|223528658|gb|EEF30674.1| Cytochrome c oxidase copper chaperone, putative [Ricinus communis] Length = 80 Score = 112 bits (280), Expect = 8e-30 Identities = 49/61 (80%), Positives = 55/61 (90%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 +++GS S P+SKPKK+ICCACPDTKKLRDECIVEHGESAC KWIEAHR+CLRAEGFN Sbjct: 20 QNKGSAITPSVPESKPKKKICCACPDTKKLRDECIVEHGESACAKWIEAHRQCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_003540108.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|571493618|ref|XP_006592605.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|571493620|ref|XP_006592606.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|571493622|ref|XP_006592607.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|955354582|ref|XP_014620418.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|955354588|ref|XP_014620419.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Glycine max] gi|734328191|gb|KHN05948.1| Cytochrome c oxidase copper chaperone [Glycine soja] gi|947077301|gb|KRH26141.1| hypothetical protein GLYMA_12G154400 [Glycine max] Length = 80 Score = 112 bits (280), Expect = 8e-30 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 K++GS +V++ +SKPKK+ICCACPDTK+LRDECIVEHGESAC KWIEAHR CLRAEGFN Sbjct: 20 KNEGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHRLCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_007021482.1| Cytochrome C oxidase copper chaperone isoform 2, partial [Theobroma cacao] gi|508721110|gb|EOY13007.1| Cytochrome C oxidase copper chaperone isoform 2, partial [Theobroma cacao] Length = 109 Score = 113 bits (282), Expect = 9e-30 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +1 Query: 97 TSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 ++V+SGP+SKPKK+ICCACP+TKKLRDECIVEHGE AC KWIEAHRKCLRAEGFNV Sbjct: 54 SAVTSGPESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV 109 >ref|XP_007152970.1| hypothetical protein PHAVU_004G175600g [Phaseolus vulgaris] gi|561026279|gb|ESW24964.1| hypothetical protein PHAVU_004G175600g [Phaseolus vulgaris] Length = 80 Score = 112 bits (279), Expect = 1e-29 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 K++GS + ++G ++KPKK+ICCACPDTK+LRDECIVEHGESAC KWIEAHR CLRAEGFN Sbjct: 20 KNEGSATTATGAETKPKKKICCACPDTKRLRDECIVEHGESACAKWIEAHRLCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >gb|KYP42360.1| Cytochrome c oxidase copper chaperone [Cajanus cajan] Length = 80 Score = 111 bits (277), Expect = 2e-29 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 K++GS +V +G +SKPKK+ICCACPDTK+LRDECIV+HGE+AC KWIEAHR CLRAEGFN Sbjct: 20 KNEGSVTVETGIESKPKKKICCACPDTKRLRDECIVQHGEAACAKWIEAHRLCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_003527251.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Glycine max] gi|571462034|ref|XP_006582176.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Glycine max] gi|734411064|gb|KHN35758.1| Cytochrome c oxidase copper chaperone [Glycine soja] gi|947106903|gb|KRH55286.1| hypothetical protein GLYMA_06G242800 [Glycine max] gi|947106904|gb|KRH55287.1| hypothetical protein GLYMA_06G242800 [Glycine max] Length = 80 Score = 110 bits (276), Expect = 3e-29 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 K+ GS +V++ +SKPKK+ICCACPDTK+LRDECIVEHGESAC KWIEAHR CLRAEGFN Sbjct: 20 KNVGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHRLCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_012848739.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Erythranthe guttata] gi|604346500|gb|EYU44944.1| hypothetical protein MIMGU_mgv1a017321mg [Erythranthe guttata] Length = 82 Score = 110 bits (276), Expect = 3e-29 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = +1 Query: 109 SGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 SGPDSKPKK+ICCACPDTKKLRDEC+VEHGES+CEKWIEAH++CLRAEG+N Sbjct: 23 SGPDSKPKKKICCACPDTKKLRDECVVEHGESSCEKWIEAHKRCLRAEGYN 73 >dbj|BAU02939.1| hypothetical protein VIGAN_11253600 [Vigna angularis var. angularis] Length = 80 Score = 110 bits (274), Expect = 7e-29 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 K+ GS + ++G ++KPKK+ICCACPDTK+LRDECIVEHGE+AC KWIEAHR CLRAEGFN Sbjct: 20 KNDGSVTAATGAETKPKKKICCACPDTKRLRDECIVEHGEAACAKWIEAHRLCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_012084961.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Jatropha curcas] gi|802716325|ref|XP_012084962.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Jatropha curcas] gi|643714555|gb|KDP27058.1| hypothetical protein JCGZ_20993 [Jatropha curcas] Length = 80 Score = 110 bits (274), Expect = 7e-29 Identities = 47/61 (77%), Positives = 56/61 (91%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 +++GS +S P++KPKK+ICCACP+TKKLRDECIVEHGESAC KWIEAHR+CLRAEGFN Sbjct: 20 QNKGSAITTSLPETKPKKKICCACPETKKLRDECIVEHGESACAKWIEAHRQCLRAEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] gi|568820489|ref|XP_006464748.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Citrus sinensis] gi|557555081|gb|ESR65095.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] gi|641843589|gb|KDO62488.1| hypothetical protein CISIN_1g045334mg [Citrus sinensis] Length = 80 Score = 110 bits (274), Expect = 7e-29 Identities = 48/60 (80%), Positives = 52/60 (86%) Frame = +1 Query: 85 DQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 +QG SG +SKPKK+ICCACP+TKKLRDECIVEHGE AC KWIEAHRKCLRAEGFNV Sbjct: 21 NQGLEVTKSGTESKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRAEGFNV 80 >ref|XP_010112978.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|703162551|ref|XP_010113080.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|587948910|gb|EXC35137.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|587978046|gb|EXC62695.1| Cytochrome c oxidase copper chaperone [Morus notabilis] Length = 80 Score = 109 bits (272), Expect = 1e-28 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = +1 Query: 82 KDQGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFN 261 ++ GST G D+KPKK+ICCACP+TKKLRDECIVEHGE AC KWIEAHRKCLR+EGFN Sbjct: 20 QNHGSTVNKPGTDTKPKKKICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLRSEGFN 79 Query: 262 V 264 V Sbjct: 80 V 80 >ref|XP_010273248.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Nelumbo nucifera] Length = 80 Score = 109 bits (272), Expect = 1e-28 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 88 QGSTSVSSGPDSKPKKRICCACPDTKKLRDECIVEHGESACEKWIEAHRKCLRAEGFNV 264 QGST+ +SG D+KPKK+ICCACP+TKKLRDECIVEHGE+AC KWIEAHR CLRAEGFNV Sbjct: 23 QGSTA-ASGADTKPKKKICCACPNTKKLRDECIVEHGEAACTKWIEAHRACLRAEGFNV 80