BLASTX nr result
ID: Rehmannia28_contig00005037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00005037 (494 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831282.1| PREDICTED: NADPH--cytochrome P450 reductase-... 64 5e-09 gb|ABK92896.1| unknown [Populus trichocarpa] 62 7e-09 gb|ACF83106.1| unknown [Zea mays] 58 2e-08 gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens] 62 2e-08 gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase is... 62 2e-08 ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-... 62 2e-08 ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase fam... 62 3e-08 ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-... 62 3e-08 gb|ABR25415.1| NADPH-cytochrome p450 reductase, partial [Oryza s... 57 5e-08 gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea] 61 6e-08 ref|XP_003610109.1| NADPH-cytochrome P450 family 2 reductase [Me... 60 8e-08 gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum] 58 9e-08 ref|XP_015897476.1| PREDICTED: NADPH--cytochrome P450 reductase-... 60 1e-07 ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase ... 60 1e-07 gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea] 60 1e-07 gb|KMZ72280.1| hypothetical protein ZOSMA_168G00160 [Zostera mar... 60 1e-07 gb|AHB33950.1| cytochrome P450 reductase [Santalum album] 60 1e-07 gb|AJW67229.1| NADPH-cytochrome P450 reductase [Camptotheca acum... 60 1e-07 gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza] 60 1e-07 ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Popu... 59 2e-07 >ref|XP_012831282.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Erythranthe guttata] gi|604343511|gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata] Length = 705 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVKNLQMNGRYLRDVW Sbjct: 676 VQEQGSLDNSKTESFVKNLQMNGRYLRDVW 705 >gb|ABK92896.1| unknown [Populus trichocarpa] Length = 183 Score = 61.6 bits (148), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVK LQMNGRYLRDVW Sbjct: 154 VQEQGSLDNSKTESFVKGLQMNGRYLRDVW 183 >gb|ACF83106.1| unknown [Zea mays] Length = 68 Score = 57.8 bits (138), Expect = 2e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SK ESFVKNLQM GRYLRDVW Sbjct: 39 VQEQGSLDSSKAESFVKNLQMEGRYLRDVW 68 >gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens] Length = 709 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTESFVKNLQMNGRYLRDVW Sbjct: 680 VQEQGSLDSSKTESFVKNLQMNGRYLRDVW 709 >gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa x Populus deltoides] Length = 712 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVK+LQMNGRYLRDVW Sbjct: 683 VQEQGSLDNSKTESFVKSLQMNGRYLRDVW 712 >ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica] Length = 712 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVK+LQMNGRYLRDVW Sbjct: 683 VQEQGSLDNSKTESFVKSLQMNGRYLRDVW 712 >ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus trichocarpa] gi|13183564|gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa x Populus deltoides] gi|550336552|gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus trichocarpa] Length = 712 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVK LQMNGRYLRDVW Sbjct: 683 VQEQGSLDNSKTESFVKGLQMNGRYLRDVW 712 >ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica] Length = 712 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNSKTESFVK LQMNGRYLRDVW Sbjct: 683 VQEQGSLDNSKTESFVKGLQMNGRYLRDVW 712 >gb|ABR25415.1| NADPH-cytochrome p450 reductase, partial [Oryza sativa Indica Group] Length = 72 Score = 56.6 bits (135), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLDNS TES+VK+LQM GRYLRDVW Sbjct: 43 VQEQGSLDNSNTESYVKSLQMEGRYLRDVW 72 >gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea] Length = 706 Score = 60.8 bits (146), Expect = 6e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGS+DNSKTESFVKNLQM GRYLRDVW Sbjct: 677 VQEQGSMDNSKTESFVKNLQMTGRYLRDVW 706 >ref|XP_003610109.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula] gi|355511164|gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula] Length = 701 Score = 60.5 bits (145), Expect = 8e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 LQEQGSLDNSKTES VKNLQM GRYLRDVW Sbjct: 672 LQEQGSLDNSKTESMVKNLQMTGRYLRDVW 701 >gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum] Length = 141 Score = 57.8 bits (138), Expect = 9e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 429 QEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 Q+QGSLDNSKTESFVKNLQ GRYLRDVW Sbjct: 113 QDQGSLDNSKTESFVKNLQTTGRYLRDVW 141 >ref|XP_015897476.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Ziziphus jujuba] gi|1009105417|ref|XP_015898145.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Ziziphus jujuba] Length = 681 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTES VKNLQMNGRYLRDVW Sbjct: 652 VQEQGSLDSSKTESLVKNLQMNGRYLRDVW 681 >ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus grandis] gi|629114031|gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis] Length = 683 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTES VKNLQMNGRYLRDVW Sbjct: 654 VQEQGSLDSSKTESLVKNLQMNGRYLRDVW 683 >gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea] Length = 683 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTESFVKNLQM GRYLRDVW Sbjct: 654 VQEQGSLDSSKTESFVKNLQMTGRYLRDVW 683 >gb|KMZ72280.1| hypothetical protein ZOSMA_168G00160 [Zostera marina] Length = 690 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQG LDNSKTESFVKNLQM GRYLRDVW Sbjct: 661 VQEQGCLDNSKTESFVKNLQMEGRYLRDVW 690 >gb|AHB33950.1| cytochrome P450 reductase [Santalum album] Length = 704 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 + EQGSLDNSKTES VKNLQMNGRYLRDVW Sbjct: 675 VHEQGSLDNSKTESMVKNLQMNGRYLRDVW 704 >gb|AJW67229.1| NADPH-cytochrome P450 reductase [Camptotheca acuminata] Length = 708 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTES VKNLQMNGRYLRDVW Sbjct: 679 VQEQGSLDSSKTESMVKNLQMNGRYLRDVW 708 >gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza] Length = 712 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGSLD+SKTESFVKNLQM GRYLRDVW Sbjct: 683 VQEQGSLDSSKTESFVKNLQMTGRYLRDVW 712 >ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa] gi|550318433|gb|ERP49886.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa] Length = 471 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 432 LQEQGSLDNSKTESFVKNLQMNGRYLRDVW 343 +QEQGS DNS+TESFVK+LQMNGRYLRDVW Sbjct: 442 VQEQGSFDNSRTESFVKSLQMNGRYLRDVW 471