BLASTX nr result
ID: Rehmannia28_contig00003976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003976 (744 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 77 5e-22 gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum]... 69 3e-12 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythr... 62 2e-09 gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partia... 57 1e-07 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 77.0 bits (188), Expect(2) = 5e-22 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 24 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRVNSHSFF 149 MKVDY S+ FQ SIIPSRTKHESFDSFGSHAQLL+VNSH FF Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFF 42 Score = 55.5 bits (132), Expect(2) = 5e-22 Identities = 28/39 (71%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +1 Query: 145 FFYECNEPILSSFFKVQKN-ESNAKQKYLEDSSDKIKNM 258 FFYECNEPI SS F QK+ E+N KY EDSSDKIKNM Sbjct: 41 FFYECNEPIFSSLFIFQKDIETNVIPKYSEDSSDKIKNM 79 >gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224350|prf||1102209D ORF 4 Length = 64 Score = 69.3 bits (168), Expect = 3e-12 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -2 Query: 293 EEKKRNNFADNYIFLILSEESSKYFCFALDSF-FWTLKKEERIGSLHS 153 ++KKRNNFADNYIF ILSEESS+YF L S FW + KEE+IGSLHS Sbjct: 17 KKKKRNNFADNYIFFILSEESSEYFGITLVSISFWNMNKEEKIGSLHS 64 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythranthe guttata] Length = 70 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 24 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRVNS 137 MKVDYL V+F+ SIIPSRTKHES DSFGSH QLLR S Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLLRCKS 38 >gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partial [Erythranthe guttata] Length = 71 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 39 LSVYFQTSIIPSRTKHESFDSFGSHAQLLR 128 LSV+F+TSIIPSRTKHESFD FGSHAQLLR Sbjct: 13 LSVHFKTSIIPSRTKHESFDLFGSHAQLLR 42